SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|62104|fgeneshTA2_pg.C_scaffold_35000032 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|62104|fgeneshTA2_pg.C_scaffold_35000032
Domain Number 1 Region: 1119-1220
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000542
Further Details:      
 
Domain Number 2 Region: 795-899
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 3 Region: 1327-1430
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000691
Further Details:      
 
Domain Number 4 Region: 1222-1324
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 
Domain Number 5 Region: 1478-1588
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 6 Region: 1012-1117
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 7 Region: 900-1012
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00064
Further Details:      
 
Domain Number 8 Region: 1743-1934
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-26
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 9 Region: 609-797
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-21
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 10 Region: 1950-2120
Classification Level Classification E-value
Superfamily Fibronectin type III 4.2e-17
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 11 Region: 329-369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000144
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 12 Region: 1-104
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000157
Family YWTD domain 0.00035
Further Details:      
 
Domain Number 13 Region: 175-211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 14 Region: 1648-1686
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 249-290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 16 Region: 438-476
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 17 Region: 210-251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 292-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 19 Region: 1698-1739
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 20 Region: 569-607
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 1595-1635
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 22 Region: 1449-1483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 23 Region: 382-426
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 24 Region: 486-529
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 532-565
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  jgi|Triad1|62104|fgeneshTA2_pg.C_scaffold_35000032
Domain Number - Region: 117-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|62104|fgeneshTA2_pg.C_scaffold_35000032
Sequence length 2216
Sequence
MDGTGITTIVQSNLGYPSGLALDIARQQLYWTDKTRHIIETATSQGHSRRTIITSNVTYP
TAIAVFKDSIYWADSELKKIFQANNNGGNVKVIASSLTYLTDVKAFRQASQTGTNGCANN
NGGCSHLCAPLPNNGHVCLCPDNAKTITSNGKMTCVCESGEVLQPGGFCSATNSSSCKSN
QFTCNNHKCIPKSWHCDHDNDCGDNSDELGCSFQTCASWQFTCSDGRCISNFRKCDFIKD
CRDGSDELNCVRPNCTSDEFRCNNKRCIRKSYVCDGDNDCYDNSDEKYCVSSHSCKSSEF
RCKNGACIPKTFFCDKFNDCGDNSDEPKKCTPKPCTINQFVCNNGECIPNIWRCDGIADC
GDSSDEKNCNTTTTTAAPTTQSSQCGSNQFKCKVTKFCIPLSYVCDGVVDCQGFFIPDSS
DEANCPTTQPSGTSTPSSCGSNSFACLSGGCIPKASVCNHVTDCSDGSDELDCGFTAAPT
KTTIMPTTPTNCSSQQFDCGAGSLPRCIPASFRCDNEQDCSNDADERHCQACSGFKCANG
VCLKKNSQVCNGINECGDNSDEKHCASHQCSNSEFRCTSGQCIVKSGRCDGFNQCSDGSD
EKSCDIVSSLVAAPFSAHSLRISWKYVQNSKYQVDHYRIYYRISGHNLDANYWPSYVDVP
KFYHSKIISNLQPQTTYDATVTIITKSAAVLRKAPFVTTSTYASKPLPPKNLKAFVLAAN
KIKVTWEASSAPGVVIKNYKVAYRFGFLDTTITTRNSFVIISNLIPFTTYYVRVAAGTYD
NVFSDYTNEYVVHTAPAVRITNGKYEFEGRVEVFHNNEWGTVCDGNWNIKAATVVCKQLG
YYEAVQAVYFGQFGGSQGKIWLNNVHCSGSESSLLDCTHSGWSNTTCTHANDAGVVCSQA
PVRLVGGLSSAEGRVEIKHNGFWGTICNFGWRIATSNVVCRSLGFPGAKPVNLVFGQTNN
FGPGNGTVWLSNVRCQGNESFITECPYSGWGISSSACNSHRYDVGVSCLTKPVRLVTANQ
VNVYKQGTIEVSHKGKWGTICDHKWDQNDAVVICKQLGYTGAIRVAKMAEFGQGNGTVWL
TDVQCKGNELNLHQCPSSGWGNNKCKHTHDAGVVCSYPMVRLVGGNQPNQGRLEINFNGV
WGTVCDDRFDITDANVVCKQLGFIGAAAALGRAPFGQGNGPIWLDEVQCNGTEQSIGDCA
HNNWNDHNCGHNEDVGIVCDTSEVRLVGGNSTREGRLEIIHNGRWGTICSNGFTKVDADV
ACRELGFSQADSVTSTSHFGSGTGPVWMQGVACKGSEKHLKECHFSGWGNSNCAHTNDVG
IICSIPPVRLAGGSNGTNYAEGRVEIFHRQKWGTICDDYWDLNDANVICRQLKLPPASAA
PKNAFFGAGTGPIWLDDVKCTGSETYINQCNTSAWQSHNCIHKEDAGVVCGMKPTMPLPT
VKPIQCSSNQKVFTCKPNECIPMFGRCDGISQCSNGADEKNCLRLKTTTNNYTGMVEINH
RGLWGTVCDDFWNLPDAIVLCRQLGFKGALQPLVMGQGGQGSANQPIWLDNVLCKGNETD
IRNCQHSQFGVHNCDHTEDAGVICASGTAVPVTPTPSGPCHHWQFACDNNQKCIWFFDLC
DNVTDCQDGSDEANCGGSTTVQPTGTTTTGQCGHGRFKCHNGQCINSTYVCNKRADCADG
SDELNCGFSLGPTPSPGCSDTQFRCQFSKTCIPNEALCNGINDCTDGSDEHNCKHPLYFV
SQLAAIKIASYQVTLGWTLTRTPQQYSFKVYSRQTHSGKSWKMEGQTSNFTYVVKNLSPF
TQYSFTVSVIEPNRNGLKATPISIRTLAGKPGSPLNVKASSIHSSSIAVIWMAPKQSNGN
ILFYGVNKLITIFIHGGSIMSKVIKTSGLTNPNGPGLRYIIDNLRANTNYYIQVAAYSST
QGYGPKSPQIQVKTSVFEAPSRLNISMDPSTLKVVVTWKPAASSVKIQSYDLTVRANDPS
SCVPIRYVIVDASVHTANIKHLIPGMEYIFSIAAVADGGQKYSGNSEIFVSKGVKPIPRD
LSISATTNAIYLNWKEPVLAQGMKILNYYVHESVSENSGSKDYTTTKTTFSRPLTNTTYL
YRVSANTNFGSGPCSKFLTYNYYPVPTAAPQSLTTILEISLPIAAVAVLVLIGACYYFNS
SRRLRNRLQTFVGSHFRRDTDEATFLMSGDDDDDVLNDDGLSANDPTSDDDGLIRA
Download sequence
Identical sequences B3SCU9
XP_002118074.1.101920 10228.JGI62104 jgi|Triad1|62104|fgeneshTA2_pg.C_scaffold_35000032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]