SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|62105|fgeneshTA2_pg.C_scaffold_35000033 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|62105|fgeneshTA2_pg.C_scaffold_35000033
Domain Number 1 Region: 96-241,326-605
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 6.28e-35
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.014
Further Details:      
 
Domain Number 2 Region: 748-875
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000017
Family YWTD domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|62105|fgeneshTA2_pg.C_scaffold_35000033
Sequence length 875
Sequence
MALMKLFLIFSAFILLAFAKDDSFVFNAENNQQLPAHTVVTERQNFYQITLPKKIPIKEA
VKQVFHSKERIKRANTAPPPAPNGTSVANLKDSTHRLIIHWSGQGSGTIIVVTGDNFFSN
TSYSRIYISTNYGKTFVNRTTDFRLLNGNPSSVDNFYTSPIDFRRKIFADVAHKYLFVTF
DEGQSVLPIKITFKAYRIVPHPSVADYVLALDTSDNNKLYASNDFGTTWKLLDVNIKAFY
WGKPNMDPSQTVFLERQDIGGLATMIKLDFIFQTGIKRTVLATNGTELYMQGSYIFVVKS
NKRGFLDLLVSKNRGALQIANFPLKNHKNQDYFIVDSTTDQVLVVVDNNHKGMDLYISDA
SGLQYTLSLQRVLYFNPFLHATPPVHKYDLRSPLFADITKLKGLLGVYVATQLTKPDSQN
FIYITTLITYNNGAKWKSIKPPATDSNGNSYPACISNSSKSCSLHLGLRYTAYYQSPFPS
AVYTSASAPGFILGHGSVGANLTSRNISMYISTDGGFDWREAMKGQFMFAVADHGGLIAA
VRRYYITNVIYYSWDEGESWSTYIFNSTAMLPYGLTTEPGEQTTVFTIVGSPVGHHEWTI
VQIDMKNVLGRSCTLNDYKKWVPSDKLDGAPGTKCVLGRKMTYERRKTKSRCYNGRNYDR
PISVQNCTCIRDDFECDEGYYHSFFTGNCFLSASLAQPPQIPVSCPEGSFYYRTRGYRKI
ADDTCFGGVENTIGPQKTLCPVAKLSEFLLFSQRFSIGRFRFGASIAETLPINLIGVSFI
DYDFSQNCLYWGENGQTPSIRRMYLNGTGWPEVIVSTKIAQVGGMALDWISNNIYWIDQK
RKELSVAKKDGTNRRTLLTTNMDNAESLILDPARG
Download sequence
Identical sequences B3SCV0
jgi|Triad1|62105|fgeneshTA2_pg.C_scaffold_35000033 XP_002118075.1.101920 10228.JGI62105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]