SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|62730|fgeneshTA2_pg.C_scaffold_540000001 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|62730|fgeneshTA2_pg.C_scaffold_540000001
Domain Number 1 Region: 36-92
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000405
Family Type I dockerin domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|62730|fgeneshTA2_pg.C_scaffold_540000001
Sequence length 271
Sequence
MKPGYPNITGRPLEIIDNSLQYLNSNIEVKKCVKPAMGDSNGDCSFNIMDAAYIKIESSK
ALQPLNVSLDYDHNQVVDYADALFLVKVFYNLARFIKSVSVNIPHNKTDCKLKIVLQLMK
GYGEVTSDKPDLYVAFTYGNNSIAHFMSTSRFEVGQMMREGTVTGNTINGVIVKAESDNA
RNYHISATTSHAIGKVGISIFQVLRDSRNSVGNIAISSSVGTKQPYLYSETVKIQLASNL
SVVYKNGFSPMQIYNINTSTYLCYYPVTTKQ
Download sequence
Identical sequences B3SEP5
10228.JGI62730 jgi|Triad1|62730|fgeneshTA2_pg.C_scaffold_540000001 XP_002118714.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]