SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|28388|e_gw1.8.296.1 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|28388|e_gw1.8.296.1
Domain Number 1 Region: 273-346
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 
Domain Number 2 Region: 107-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.94e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 21-95
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|28388|e_gw1.8.296.1
Sequence length 360
Sequence
MNISCQRRHTEIIKDNSSGDKVVLKLLIPNYAAGSIIGKGGDVINDLQNDSKTRIRLSHN
NDTFPGTKERVIVITGSIAGVRQVNRFILEKVSEEGKADKAIQYGVLDKNRNRQLKMIVP
NAAAGVIIGKGGSNIKEIQDKSGAHVQVSQKKAQYAIDERILTVTGEFNERLTAWELIIW
KCLEDINNLPNTSVSYSHVEPAGTLPALHSNYYGGGNANDRPMDSSAASYDPYTSERYSP
TQVTQDAQADRQYGMQSYPPTARNNRPSSYGETVIKIPVPDSIIGAILGKRGKVISDIQN
ISGAHIQVSQRGDYIPGTKDREVTVTGTNDAAHYADKLIKGYLDKEYKKQASNFVSPQNY
Download sequence
Identical sequences B3S381
XP_002114790.1.101920 jgi|Triad1|28388|e_gw1.8.296.1 10228.JGI28388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]