SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|51134|fgeneshTA2_pm.C_scaffold_31000008 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|51134|fgeneshTA2_pm.C_scaffold_31000008
Domain Number 1 Region: 154-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-97
Family Protein kinases, catalytic subunit 0.000000000693
Further Details:      
 
Domain Number 2 Region: 3-106
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-21
Family Pleckstrin-homology domain (PH domain) 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|51134|fgeneshTA2_pm.C_scaffold_31000008
Sequence length 489
Sequence
MPLVKEGLLLKRGEYIKNWRPRWFQLYSDGSFIGYKEKPKSSNVDPLNNFSVAKCQLMKS
DKPKPNCFIIRCFQWTTLVERTFHVETPAERESWIVAIQNVADKLREEEENKSKGEQASE
YVSRSGKLVYIYIYTAHFFSTLNRTTIFQILQRLEDFDMLQVLGKGTFGKVMLAREKASG
EIFAVKILKKEVIVAKDEVAHTLTENRVLQNCRHPFLTELKYSFQTKDRLCFVMEYVNGG
ELFFHLSRERIFTEDRTRFYGAEITLALKYLHERNIVYRDLKLENLLLDKEGHIKIADFG
LCKEQISFGATTTTFCGTPEYLAPEVLDDNDYGRSVDWWGLGVVMYEMMCGRLPFYNKDH
EVLFELILMEDIKFPSRISERARSLLGGLLTKDPKKRLGGGVRDAEEVTEHEFFEEINWQ
DLYDRKISPPFKPHIKSTTDTSNFDSDFTSETPRLTPPDHHGGPVDVKEGAPHFEEFSYV
APKGGELSK
Download sequence
Identical sequences B3SCA2
10228.JGI51134 jgi|Triad1|51134|fgeneshTA2_pm.C_scaffold_31000008 XP_002117864.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]