SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|54881|fgeneshTA2_pg.C_scaffold_3000888 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|54881|fgeneshTA2_pg.C_scaffold_3000888
Domain Number 1 Region: 153-401
Classification Level Classification E-value
Superfamily vWA-like 1.15e-55
Family Integrin A (or I) domain 0.00000373
Further Details:      
 
Domain Number 2 Region: 48-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000183
Family Plexin repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 539-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Triad1|54881|fgeneshTA2_pg.C_scaffold_3000888
Domain Number - Region: 578-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00865
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|54881|fgeneshTA2_pg.C_scaffold_3000888
Sequence length 760
Sequence
MDLLFRMNNCGILVTSDCRLDRFVMMIAINVRVFLILAYLLVVAVIDPPNPCQPLKACEV
CIANPECAWCADFKYEGENLYRCDAADNHEVQGCEDIVNPQSSLVNRTDVDDDLDSILLN
NFTDSVLQLPRFNVKLRTGQPVQISFNIVSTQRSPVDMYFLYDISRSMYGDLDMLKKRAI
TLALEMKKLSRDTRWGFGTFVDKFVSPFRLQAKEKLVNPCNDGEKEPLQCIRPYSFRNNL
SLTNNMTSFQEVVNAQMVSSNLDAPESGLDALLQLSVCNEIINWRPYARHIVVYASDADF
HYAGDGKLAGLVIPNDAKCHLSEHGEHETETVMDYPSIGQLKEKLRENRIIPVFLIRNRY
QSYGAFAELLDNLQGVMGWLGHLEAESSNILGLINSSYDAVSTTIELYNDPTDLLKFEYF
SNCTKINVHVVGVGDLVVEIEHLCRCGCTRNTTVSEKCSYNGTLRCGQCNCNRGRSGDFC
ECDASLSNTVRDCDVTDNSTCNYRGHCVCQQCQCNQDDRGLIYGKYCQCDNFTCPADRNG
NLCSGHGRCDCGTCKCNHGWTGIDCGCTLSIAQCIDPKSRKICNGKGNCNCGTCDCHPKS
GYNGKTCQSCLFCPTACDVHGQCLSCWLHKQPVCSDYCNNITITNVTELDTRDEWYCYVQ
DINSSCYFKFIIEGETNRNLLTSVSCPVFISQSVLIVSIMVNIVGFGLLCLIAWKIAVTI
KDKIDYQKFTKKIWVNASIQVQLSNFPVMLLQIEDRNKKV
Download sequence
Identical sequences B3RT92
XP_002111182.1.101920 10228.JGI54881 jgi|Triad1|54881|fgeneshTA2_pg.C_scaffold_3000888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]