SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17544871|ref|NP_518273.1| from Ralstonia solanacearum GMI1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17544871|ref|NP_518273.1|
Domain Number 1 Region: 191-228
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 0.000000104
Family MHC antigen-recognition domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17544871|ref|NP_518273.1|
Sequence length 249
Comment lipoprotein [Ralstonia solanacearum GMI1000]
Sequence
MNIMSQGLTMAAIACALAASGAAAETISVVGTGAQTTASGTEPAQQYDPKAQTAGATVVW
SETTTRLNSAVSTRTRTNVTTSVANGIATVDASEGGTAVERYTSDADGNRLTRTYLNNGN
VCTYAPKRDMLNFPLSVGKTWTTTWQYSCAAGYREFATLNAAVEALEVLAIPAGTFNALR
IHYALAITNSNDSQLPGGSTGSAAYNQDYRCWWEVDGGRIVKCDFTYTYPAGAPSNFTKT
FSQVATSVQ
Download sequence
Identical sequences A0A223GIF3 Q8Y329
gi|17544871|ref|NP_518273.1| WP_011000119.1.81933 267608.RSc0152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]