SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000003 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000003
Domain Number 1 Region: 344-373,462-579
Classification Level Classification E-value
Superfamily TIMP-like 2.98e-22
Family Netrin-like domain (NTR/C345C module) 0.011
Further Details:      
 
Domain Number 2 Region: 255-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family EGF-type module 0.028
Further Details:      
 
Domain Number 3 Region: 374-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000003   Gene: ENSMMUG00000000004   Transcript: ENSMMUT00000000004
Sequence length 581
Comment pep:known_by_projection chromosome:MMUL_1:20:2480443:2483111:1 gene:ENSMMUG00000000004 transcript:ENSMMUT00000000004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWPWGLLLTAGTLFAALSPGPPAPADPCHDEGGAPRGCVPGLVNAALGREVLASSTCG
RPATRACDASDPRRAHPPALLTSPGGTASPLCWRSEWLPRAPLNVTLTVPLGKAFELVFV
SLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPADGPAGPGPEALCFPA
PQAQPDGSGLLAFSVQDSSPPGLDLDSSPVLQDWVTATDIRVVLTRPSAAGDPRDMEAIV
PYSYAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRA
TARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRD
PGRALSDRRACRACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAP
CVKTPIPGPTEDSSPVQPQGERRWGKGGRGVCRRLLTPPPLTLPAAVQVAVGARGEARGA
WTRFPVAVLAVFRSGEERARRGSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGA
GGRGPGLSAARGSLVLPWRDAWTRRLRRLQRRERRGRCSAA
Download sequence
Identical sequences ENSMMUP00000000003 ENSMMUP00000000003 9544.ENSMMUP00000000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]