SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000113 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000113
Domain Number 1 Region: 64-99
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000000106
Family GLA-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000113   Gene: ENSMMUG00000000084   Transcript: ENSMMUT00000000124
Sequence length 100
Comment pep:known chromosome:MMUL_1:1:134844863:134845789:1 gene:ENSMMUG00000000084 transcript:ENSMMUT00000000124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALTLLALLALATLCITGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
APYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV
Download sequence
Identical sequences A0A0D9S4Y6 A2D4U1 A2D670 A2T6K4 G7MDZ1
ENSMMUP00000000113 NP_001074237.1.72884 XP_007974945.1.81039 XP_011768097.1.29376 9544.ENSMMUP00000000113 ENSMMUP00000000113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]