SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000115 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000115
Domain Number 1 Region: 387-446
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000036
Family ATI-like 0.017
Further Details:      
 
Domain Number 2 Region: 2-57
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000376
Family BSTI 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000115
Domain Number - Region: 1104-1145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000311
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000115   Gene: ENSMMUG00000000087   Transcript: ENSMMUT00000000126
Sequence length 1174
Comment pep:known chromosome:MMUL_1:14:119540133:119628691:1 gene:ENSMMUG00000000087 transcript:ENSMMUT00000000126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LECPENSHFEECIICTETCETLALGPICVDSCSEGCQCDEGYALLGSQCVTRSECGCNFE
GHQLVTNETFWVDLDCQIFCYCNGTDNSVHCETVPCKDDEYCMEEGGLYYCQARTDASCI
VSGYGHYLTFDGFSFDFQTSCPLILCTTGSRPSSDSFPKFVVTAKNEDRDPSLALWVKQV
DVTVFGYSIVIHRAYKHTVLVNSERLYLPLKLGQGKINIFSFGFHVVVETDFGLKVVYDW
KTFLSITVPRSMQNSTYGLCGRYNGNPDDDLEMPIGLLASSVNEFGQSWVKRDTFCQVGC
GDRCPSCAKVEGFSKVQQLCSLIPNQNAGFSKCHSKVNPTFFYKNCLFDSCIDGGAVQTA
CSWLQNYASTCQTQGITVTGWRNYTSCTVTCPPNSHYESCVSVCQPRCAAIRLKSDCSHY
CVEGCQCDAGYVLNGKSCILPHSCGCYSDGKYYEPKQLFWNSDCTRRCRCFRRNLIQCDP
RQCKSDEECALRNGVRGCFSTKTSYCLAAGGGVFRTFDGAFLRFPANCAFVLSTICQKLP
DISFQLIINFDKWSAPNLTIISPVYFYINEEQILISDRNTVKVNGTQVNVPFITGLATKI
YSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCGLCGNFNGDLTDDYVTLRGKPV
VSSVVLAQSWKTNGMQKRPLAPSCNELQFSQYAAMCDNVHIQKMQGDGYCLKLTDMKGFF
QPCYGLLDPLPFYESCYLDGCYNHKKFQLCGSLAAYGEACRSFGILSTEWIEKENCSGVV
EDPCVGADCPNRTCELGNGRELCGCIEPPPYGNNSHDIIDAEVTCKASQMEVSISKCKLF
QLGFEREGVRINDRQCTGIEGEDFISFQINNTKGNCGNIVQSNGTHIMYKNTIWIESANN
TGNIITRDRTINVEFACAYELDIKISLDSVVKPMLSVINLTVPTQEGSFTTKMALYKNAS
YKHPYRQGEVVLTTRDVLYVGVFVVGADSTHLILTLNKCYATPSRDSNDKLRYFIIEGGC
QNIKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHCAVSLCDSEKYSCKITCPQNSR
SATDYTKEPKEQIISVGPIRRKRLDWCEDNGGCEQICTSRVDGPLCSCVTGTLQEDGKSC
RASNSSVELQVWTLLLVMIQISLWHFVYKSGTIS
Download sequence
Identical sequences ENSMMUP00000000115 9544.ENSMMUP00000000115 ENSMMUP00000000115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]