SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000171 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000171
Domain Number 1 Region: 141-259
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-24
Family SH2 domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000171   Gene: ENSMMUG00000000129   Transcript: ENSMMUT00000000184
Sequence length 272
Comment pep:known_by_projection chromosome:MMUL_1:8:19234284:19296656:1 gene:ENSMMUG00000000129 transcript:ENSMMUT00000000184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLADSINRMKAHGFHQKKESMKKKQEEEINQIDEERTKQICKNWKEDSEWQASLRKSKAA
DEKRRSLAKQAREDYKRLSLGAQKGRGGERLQSPLRVPQKPKRPPLPPKPQFLNPAAYPQ
KPLRNQGVVRTVSSSAQEDIIRWFKEEQLPLRAGYQKTSDTIAPWFHGILTLKKANELLL
STGMPGSFLIRVSERIKGYALSHLSEDSCKHFLIDASADSYSFLGVDQLQHATLADLVEY
HKEEPITSLGKELLLYPCGQQDQLPDYLELFE
Download sequence
Identical sequences ENSMMUP00000000171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]