SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000220 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000220
Domain Number 1 Region: 93-194
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-28
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 2 Region: 195-300
Classification Level Classification E-value
Superfamily Fibronectin type III 7.55e-18
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000219
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000220   Gene: ENSMMUG00000000161   Transcript: ENSMMUT00000000233
Sequence length 383
Comment pep:known_by_projection chromosome:MMUL_1:19:18213699:18219956:-1 gene:ENSMMUG00000000161 transcript:ENSMMUT00000000233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALA
LANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGA
HGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGS
ARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVE
DSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTP
RSERSGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSH
KTRNQDEGILPSGRRGTARGKVG
Download sequence
Identical sequences ENSMMUP00000000220 9544.ENSMMUP00000000220 ENSMMUP00000000220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]