SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000223 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000000223
Domain Number - Region: 1-24
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0124
Family THAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000223   Gene: ENSMMUG00000000162   Transcript: ENSMMUT00000000236
Sequence length 52
Comment pep:known chromosome:MMUL_1:8:43439886:43445179:-1 gene:ENSMMUG00000000162 transcript:ENSMMUT00000000236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQSCSAYGCKNRYDKDKPVSFHKKKIWSHRNSFLHLLYRLLFPRLMLLLDY
Download sequence
Identical sequences A0A2I3MZ43 A0A2K5KWW6 A0A2K5UT07 A0A2K5YFK3 A0A2K6B9P0
XP_011730791.1.29376 XP_011856431.1.47321 XP_011937363.1.92194 XP_015000735.1.72884 XP_015309848.1.63531 ENSMMUP00000000223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]