SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000298 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000298
Domain Number 1 Region: 233-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000131
Family EGF-type module 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000298   Gene: ENSMMUG00000000208   Transcript: ENSMMUT00000000315
Sequence length 296
Comment pep:known_by_projection chromosome:MMUL_1:8:32930153:33030100:1 gene:ENSMMUG00000000208 transcript:ENSMMUT00000000315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIYSPDMSEVAAERSSSPSTQLSADPSLDGLPAAEDMPEPQTEDGRTPGLVGLAVPCCV
CLEAERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIFEYDSPTHLDPGGLGQD
PIISLDPTAASAVWVSSEAYTSPVSRAQSESKVQVTVQGDKAVVSFEPSAAPTPKNRIFA
FSFLPSTAPSFPSPTRNPEVRTPKSATQPQTTETNLQTAPKLSTSTSTTGTSHLVKCAEK
EKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYSTSTPFLSLPE
Download sequence
Identical sequences A0A2K5MWP9 A0A2K5TYT4 A0A2K5YYV1 A0A2K6D692
ENSMMUP00000000298 XP_005563089.1.63531 XP_011731021.1.29376 XP_015000635.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]