SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000363 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000363
Domain Number 1 Region: 286-502
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.58e-86
Family Fibrinogen C-terminal domain-like 0.00000398
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000363
Domain Number - Region: 174-244
Classification Level Classification E-value
Superfamily Influenza hemagglutinin (stalk) 0.00299
Family Influenza hemagglutinin (stalk) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000363   Gene: ENSMMUG00000000270   Transcript: ENSMMUT00000000392
Sequence length 503
Comment pep:known_by_projection chromosome:MMUL_1:10:34148992:34191974:-1 gene:ENSMMUG00000000270 transcript:ENSMMUT00000000392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQLTMLWGSLLLLVATMSVAQQTGQEAGRGCETLVVQHGHCSYTFLLPKPEPCPPGPE
ASRDSNTLQRESLANPLRLEKLPTQQVKRLEQALQNNTQWLKKLERAIKMILRSKLVQVQ
QQMAQNQTAPMLELGTSLLNQTTAQTRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQ
LLLQRQKLQQLQGQNSELEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERR
LRDVRHNSSLLQDQQHSLSQLLLLLRDLVQERVNASAPAFITAGEQVFQDCAEIQRSGAN
ASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEH
WLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQ
SSLVLQNTSFSTLDSDNDHCLCKCAEVMSGGWWFDACGLSNLNGVYYHAPDNKHKMDGIR
WHYFKGPSYSLRASRMMIRPLDI
Download sequence
Identical sequences F6X2C2
ENSMMUP00000000363 ENSMMUP00000000363 9544.ENSMMUP00000000363 XP_001112522.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]