SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000381 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000381
Domain Number 1 Region: 187-512
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.38e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 492-599
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.21e-26
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 3 Region: 127-208
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.92e-23
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0021
Further Details:      
 
Domain Number 4 Region: 65-125
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000019
Family TGS domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000381   Gene: ENSMMUG00000000278   Transcript: ENSMMUT00000000410
Sequence length 609
Comment pep:known_by_projection chromosome:MMUL_1:7:81773794:81855381:-1 gene:ENSMMUG00000000278 transcript:ENSMMUT00000000410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRPSSQSQDEDMKNKKMKESEPDSEVVKQPIFIKERLKLFEILKKDHQLLLSIYGKKGDT
NNIITVRVTDGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSL
ELLTFDNEEAQAVDTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEM
ETLQRIYGISFPDNKMMRNWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAF
IYNTLMDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPM
NCPGHCLMFAHRPRSWREMPMRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQ
IEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKVKDTPCCDSLQEDA
IICNRNFETGNCGINNVVIPYHQCATIQLDFQLPIRFNLTYVSKDGDDKKRPVIIHRAIL
GSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDH
NCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNKIHGEILVTSAIVKLKNLKKS
RTLIAEEDF
Download sequence
Identical sequences ENSMMUP00000000381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]