SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000481 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000481
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.38e-16
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 7 Region: 417-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000299
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000481   Gene: ENSMMUG00000000362   Transcript: ENSMMUT00000000524
Sequence length 517
Comment pep:known_by_projection chromosome:MMUL_1:19:62369954:62382232:-1 gene:ENSMMUG00000000362 transcript:ENSMMUT00000000524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGSELFRDVAIVFSQEEWQCLAPAQRDLYRDVMLETYNNLVSLGLAISKPDVISFLEQ
GKEPWMVERVVSGGLCPVLESRYDTKELSPKQHVYEVESPQWEIMESLTSYGLECSSFQD
DWECRSQFDRQQGNPDRHFHQMIIRHEEMPTFDQHSSLSFYQKIHTREKAFGYNKCRKDF
WQEELLINHQGIHLNEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECKECGKAFNSGS
NFIQHQRVHTGEKPYECKDCEKAFSRSSQLIEHQRTHTGEKPYQCKECGKAFNRISHLKV
HYRIHTGEKPYACKECGKTFSHRSQLIQHQTIHTGKKLYECKECGKAFNQGSTLIRHQRI
HTGEKPYECKICGKAFRVSSQLKQHQRIHTGEKPYQCKVCGRAFQRVSHLTVHYRIHTGE
KPYECKECGKAFSHCSQLIHHQVIHTEKKPYEYKECERTLSHDSTTVQPQRMHNRETHVN
IINVEKPSISTYPLLIIREFMLASNHMSGSNGESPLA
Download sequence
Identical sequences A0A2K5WPT7 F6YLL1
ENSMMUP00000000481 9544.ENSMMUP00000000481 ENSMMUP00000000481 XP_001094946.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]