SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000486 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000486
Domain Number 1 Region: 20-295
Classification Level Classification E-value
Superfamily HAD-like 6.14e-62
Family NagD-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000486   Gene: ENSMMUG00000003854   Transcript: ENSMMUT00000000529
Sequence length 300
Comment pep:known chromosome:MMUL_1:10:81571819:81580440:1 gene:ENSMMUG00000003854 transcript:ENSMMUT00000000529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGECAVPGAPELLERLARAGKAALFVSNN
SRHARPELARRFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPGAPGAVFVLGGEGLRA
ELRAAGLRLAGDPGDDPSAGDGAAPRVRAVLVGYDERFSFARLSEACAHLRDPECLLVAT
DRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDPARTLMV
GDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVPHYYVESVADLTEGLED
Download sequence
Identical sequences XP_015005779.1.72884 ENSMMUP00000000486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]