SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000512 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000000512
Domain Number - Region: 51-112
Classification Level Classification E-value
Superfamily FnI-like domain 0.0012
Family Fibronectin type I module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000512   Gene: ENSMMUG00000000384   Transcript: ENSMMUT00000000557
Sequence length 138
Comment pep:known_by_projection chromosome:MMUL_1:12:78244978:78245394:1 gene:ENSMMUG00000000384 transcript:ENSMMUT00000000557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKVCVTLHTY
Download sequence
Identical sequences Q95K75
ENSMMUP00000000512 ENSMMUP00000000512 9544.ENSMMUP00000000512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]