SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000516 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000516
Domain Number 1 Region: 3884-4122
Classification Level Classification E-value
Superfamily Plakin repeat 8.28e-88
Family Plakin repeat 0.000000022
Further Details:      
 
Domain Number 2 Region: 31-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-87
Family Calponin-homology domain, CH-domain 0.000000605
Further Details:      
 
Domain Number 3 Region: 2646-2886
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-86
Family Plakin repeat 0.0000000726
Further Details:      
 
Domain Number 4 Region: 3305-3543
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-86
Family Plakin repeat 0.0000000533
Further Details:      
 
Domain Number 5 Region: 2974-3213
Classification Level Classification E-value
Superfamily Plakin repeat 2.75e-77
Family Plakin repeat 0.000000496
Further Details:      
 
Domain Number 6 Region: 3642-3879
Classification Level Classification E-value
Superfamily Plakin repeat 3.01e-77
Family Plakin repeat 0.000000737
Further Details:      
 
Domain Number 7 Region: 4195-4236,4271-4465
Classification Level Classification E-value
Superfamily Plakin repeat 1.66e-69
Family Plakin repeat 0.000000343
Further Details:      
 
Domain Number 8 Region: 275-391
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-22
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 1153-1338
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-20
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 10 Region: 618-720
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 11 Region: 4142-4190
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000023
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 12 Region: 525-617
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000811
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 13 Region: 700-797
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000903
Family Spectrin repeat 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000516
Domain Number - Region: 1043-1152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000516   Gene: ENSMMUG00000000388   Transcript: ENSMMUT00000000562
Sequence length 4547
Comment pep:known_by_projection chromosome:MMUL_1:8:146545866:146573101:-1 gene:ENSMMUG00000000388 transcript:ENSMMUT00000000562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSGSLFPSLVVVGHVVTLAAVWHWRRGRRWAQDEQDERDRVQKKTFTKWVNKHLIKAQ
RHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNI
RNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRC
DNFTSSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPED
VDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVRANELQLRWQEYRELVLLLLQWIRHHTA
AFEERRFPSSFEEIEILWSQFLKFKEMELPAKEADKNRSKGIYQSLEGAVQAGQLKVPPG
YHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVTKLQMEAGLCEEQLNQADTLLQ
SDVRLLAAGKVPQRAGEVERDLDKADSMIRLLFNDVQTLKDGRHPQGEQMYRRVYRLHER
LVAIRTEYNLRLKAGVAAPATQVTQVTLQSVQRRPELEDSTLRYLQDLLAWVEENQHRVD
GAEWGVDLPSVEAQLGSHRGLHQSIEEFRAKIERARSDEGQLSPATRGAYRDCLGRLDLQ
YAKLLNSSKARLRSLESLHSFVAAATKELMWLNEKEEEEVGFDWSDRNTNMTAKKESYSA
LMRELELKEKKIKELQSAGDRLLREDHPARPTVESFQAALQTQWSWMLQLCCCIEAHLKE
NAAYFQFFSDVREAEGQLQKLQEALRRKYSCDRSATVTRLEDLLQDAQDEKEQLNEYKGH
LSGLAKRAKAIVQLKPRHPAHPVRSRLPLLAVCDYKQVEVTVHKGDECQLVGPAQPSHWK
VLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQLHVDMKSLLAWQSLR
RDVQLIRSWSLATFRTLKPEEQRQALHSLELHYQAFLRDSQDAGGFGPEDRLMAEREYGS
CSHHYQQLLQSLEQGAQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKEPARECA
QRIAEQQAGAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRS
LSAIYLEKLKTISLVIHSTQGAEEVLRAHEEQLKEAQAVPATLPELEATKASLKKLRSQA
EAQQPVFDALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQLLERWQAVLVQTDVRQ
RELEQLGRQLRYYRESADPLGAWLQDARQRQEQIQAVPLANSQAVREQLRQEKALLEEIE
RHGEKVEECQRFAKQYINAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDL
RTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAH
AQAKAQAEREAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQXXXXXXXXXXGQARQA
EAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLR
RQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALEELRLQAEEAERRLRQAEVERA
RQVQVALETAQRSAEVELQSKRASFAEKTAQLERSLQEEHVAVAQLREEAERRAQQQAEA
ERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAE
EQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQ
REAAAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELA
EEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLAEKLAAISEATRLKTEAEIALKEKE
AENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKASDSELERQKGLVEDTLRQR
RQVEEEILALKASFEKAAAGKAELELELGRIRSNAEDTLRSKEQAELEAARQRQLAAEEE
QRRREAEERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAEQESARQLQLAQ
EAAQKRLQAEEKAHAFAVQQKEQELQQTLQQEQSVLDRLRSEAEAARRAAEEAEEARVQA
EREAAQSRRQVEEAERLKQSAEEQAQARAQAQAAAEKLRKEAEQEAARRAQAEQAALRQK
QAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKNLLDEELQRLKAEATEAA
RQRSQVEEELFSVRVQMEELSKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEA
ARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQ
EQARRLQEDKEQMAQQLAEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAE
EDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKE
KLQQEAKLLQLKSEEMQTVQQEQLLQETQALQQSFLSEKDSLLQRERFIEQEKAKLEQLF
QDEVAKAQQLREEQQRQQQQMEQERQRLVASMEEARRRQHEAEEGVRRKQEELQQLERQR
RQQEELLAEENQRLREQLQRLEEEHRAALAHSEEVTASQVAATKTLPNGRDALDGPATET
EPEHSFDGLRQKVPAQRLQEAGILSAEELQRLAQGHTTVDELARREDVRHYLQGHSSIAG
LLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVG
PELHHKLLSAERAVTGYKDPYTGQQISLFQAMQKGLIVREHGIRLLEAQIATGGIIDPVH
SHRVPVDVAYRRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLR
LLPLTDKAAKGRELVYTDSEARDVFEKATVSAPFGKFQGKTVTIWEIINSEYFTAEQRRD
LLRQFRTGRITVEKIIKIIITVVEEQEQKGQLCFEGLRSLVPAAELLESRVIDRELYHQL
QQGERSVREVAEVDAVRQALRGANVIAGVWLEEAGQKLSVYDALKKDLLPSDVAVALLEA
QAGTGHIIDPSTSARLTVDEAVRAGLVGPEFHEKLLSAEKAVTGYRDPYTGQSVSLFQAL
KKGLIPREQGLRLLDAQLSTGGVVDPSKSHRVPLDVACARGFLDEETSRALSAPRADAKA
YCDPSTGEPVTYSELQQRCRPDQLTGLSLLPLSEKAARARQEELYSELQARETFEKTPVD
VPVGGFKGRTVTVWELISSEYFTAEQRQELLCQFRTGKVTVEKVIKILITIVEEVETLRQ
ERLSFSGLRAPVPASELLASRVLSRAQFEQLKDGKTTVKDLSELDSVRTLLQGSGCLAGI
YLEDTKEKVSIYEAMRRGLLRPSTAALLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGP
ELHEQLLSAEKAVTGYRDPYSGSTISLFQAMQKGLVLRQHGIRLLEAQIATGGIIDPVHS
HRVPVDVAYQRGYFNEEMNRVLADPSDDTKGFFDPNTHENLTYRQLLERCVEDPETGLRL
LPLKGAEKAEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSTMSLWEVMQSDLIPEEQ
RAQLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQGLASYDYVRRRLTAEDLYEARIISL
ETYNLLREGTRSLREALEAESAWRYLYGTGCVAGVYLPGSRQTLSIYQALKKGLLSAEVA
RLLLEAQAATGFLLDPVKGQRLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTI
SLFQAMKKELIPTEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEP
SEVRSYVDPSTDERLSYTQLLRRCRRDDGTGQLLLPLSDARKLTFRGLRKQITVEELVRS
QVMDEATALQLREGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRP
GTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSG
KLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEIL
TDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRR
VVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSG
RQYDIDDAIAKNLIDRSALDQYRAGTLSITEFADMLSGNASGFRSRSSSVGSSSSYPISP
AVSRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGG
IIDPSTGERFPVTDAVNKGLVDKIMVDRINLAQKAFCGLKDPRTKTKMSAAQALKKGWLY
YEAGQRFLEVQYLTGGLIEPDMPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKT
KLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAG
SRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGSSASVGGPESAVA
Download sequence
Identical sequences ENSMMUP00000000516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]