SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000550 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000550
Domain Number 1 Region: 292-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-38
Family SPRY domain 0.00015
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-20
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 85-141
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000111
Family B-box zinc-binding domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000550
Domain Number - Region: 131-237
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0549
Family Apolipoprotein A-I 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000550   Gene: ENSMMUG00000000414   Transcript: ENSMMUT00000000599
Sequence length 413
Comment pep:novel chromosome:MMUL_1:14:87975789:87981208:1 gene:ENSMMUG00000000414 transcript:ENSMMUT00000000599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDTLQAFQNELICSICMNYFIDPVTIDCGHSFCRPCLYLCWEEGREPMHCPECREISA
KSDINNNVTLKKLASLARQTRLQNINNSHSICVLHEETKELYCEVDKQLLCGPCTESPEH
MAHSHSPIGWAAEECRSNLKVSITFSHTGDETTFSLRLGVRKSQTSLQDYVSIRKVIITI
QYQKMHIFLDEEEQLHLQALEREAKELFQQLQDSQVRMTQHLERMKDMYRELWETCHMPD
VELLQVRREGPSSETGSPCWTLLPGHANVTCICHCSKQNTYNKILFNIIWIVFYCRGVGG
AQAFTSGRHYWEVDVTHSSTWILGVCQDSRTADTNIVIDSDETFLLISSKRSNRYSLSTN
SPPLIQHVQRPLGRVGVFLDYENGSVSFFDVSKGSLIYGFPPSSFSSPLRPFF
Download sequence
Identical sequences ENSMMUP00000000550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]