SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000590 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000590
Domain Number 1 Region: 46-164
Classification Level Classification E-value
Superfamily DNA clamp 2.26e-18
Family DNA polymerase processivity factor 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000590   Gene: ENSMMUG00000030184   Transcript: ENSMMUT00000000640
Sequence length 171
Comment pep:known chromosome:MMUL_1:6:34672431:34679648:-1 gene:ENSMMUG00000030184 transcript:ENSMMUT00000000640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYQGYGYPLMLFLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSE
LDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLK
PSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES
Download sequence
Identical sequences ENSMMUP00000000590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]