SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000655 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000655
Domain Number 1 Region: 100-372
Classification Level Classification E-value
Superfamily L domain-like 1.79e-48
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 53-120
Classification Level Classification E-value
Superfamily L domain-like 0.000000544
Family Ngr ectodomain-like 0.0037
Further Details:      
 
Domain Number 3 Region: 441-510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000112
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000655   Gene: ENSMMUG00000000482   Transcript: ENSMMUT00000000707
Sequence length 674
Comment pep:known_by_projection chromosome:MMUL_1:14:10314358:10328683:-1 gene:ENSMMUG00000000482 transcript:ENSMMUT00000000707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVAHPTATTTTTTTATVTATVVMTTSTMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRC
DNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDE
FPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLK
LLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIA
DDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLD
LSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGP
EKVRGMAIKDITSEMDECFETGSQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLR
IPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSI
TETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLN
QEQNAGPMAGLPLAGIIGGAVALVFLFLVLGAVCWYVHQAGELLTRERAYNRGSRKKDDY
MESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRG
YRDGGIPDIDYSYT
Download sequence
Identical sequences A0A2K5UJR4 F6YJL6
XP_001115424.1.72884 XP_005577538.1.63531 ENSMMUP00000000655 ENSMMUP00000000655 9544.ENSMMUP00000000655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]