SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000708 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000708
Domain Number 1 Region: 502-628
Classification Level Classification E-value
Superfamily TIMP-like 4.12e-28
Family Netrin-like domain (NTR/C345C module) 0.064
Further Details:      
 
Domain Number 2 Region: 332-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000053
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 395-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 262-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000163
Family Laminin-type module 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000708
Domain Number - Region: 101-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.051
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000708   Gene: ENSMMUG00000000521   Transcript: ENSMMUT00000000765
Sequence length 628
Comment pep:known chromosome:MMUL_1:11:96878761:97006239:-1 gene:ENSMMUG00000000521 transcript:ENSMMUT00000000765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCARLLLLWGCTVVAAGLSGVAGASSRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCFYSENTDLTCRQPKCDKCNAAHPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIMVFKSPRPAAMVLDRSQDFGRTWKPYKYFATNCSATFGLEDDVGKKGAI
CTSKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRND
LNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTA
GSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCD
DCQHNTEGQHCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC
PCKPGVAGRHCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCSSSNTDIDWYHEVPDFRP
VHNKSEPAWEWEDAQGFSALLHSGKCECKEQILGNAKAFCGMKYSYVLKIKILSAHDKGT
HVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDVRTGKL
IVNMKSFVQHWKPSLGRKVMDILKRKCK
Download sequence
Identical sequences A0A2K5TJR4 F7A403
ENSMMUP00000000708 9544.ENSMMUP00000000708 ENSMMUP00000000708 NP_001252984.1.72884 XP_005571960.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]