SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000770 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000770
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.95e-67
Family LplA-like 0.00000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000770   Gene: ENSMMUG00000000574   Transcript: ENSMMUT00000000831
Sequence length 373
Comment pep:known chromosome:MMUL_1:13:99083926:99085047:1 gene:ENSMMUG00000000574 transcript:ENSMMUT00000000831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPFSMKNCFQLLCNHQVPAAGFKQTVKNGLILQSVSNDVYQNLAVEDWIHDHMNLEGK
PILFFWRNSPSVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDMGNINLTFFTT
KKKYDRMENLKLILRALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTL
LCSTDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDPTLTCEVLMNAVATEYAAYHQ
IDHHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFL
DIKNGRIEICNIEAPDHWLPLEIRDKLNSSLIGSKFCPTETTMLTNILLRTCPQDHKLHS
KWNILCEKIKGIM
Download sequence
Identical sequences A0A2K5KJI3 F6ZW28
ENSMMUP00000000770 XP_001103668.1.72884 XP_011911043.1.92194 XP_011911044.1.92194 9544.ENSMMUP00000000770 ENSMMUP00000000770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]