SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000772 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000772
Domain Number 1 Region: 146-254
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-25
Family Cadherin 0.00032
Further Details:      
 
Domain Number 2 Region: 366-486
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-25
Family Cadherin 0.0031
Further Details:      
 
Domain Number 3 Region: 255-371
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 475-584
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 69-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000327
Family Cadherin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000772   Gene: ENSMMUG00000000576   Transcript: ENSMMUT00000000833
Sequence length 785
Comment pep:known_by_projection chromosome:MMUL_1:18:59181783:59314151:1 gene:ENSMMUG00000000576 transcript:ENSMMUT00000000833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGKVEFYHFLQLIALFLCFSGMSQAELTRSRSKPYFQSGRPRTKRSWVWNQFFVLEEY
MGSDPLYVGKLHSDVDKGDGSIKYILSGEGASSIFIIDENTGDIHATKRLDREEQAYYTL
RAQALDRLTNKPVEPESEFVIKIQDINDNEPKFLDGPYTAGVPEMSPVGTSVVQVTATDA
DDPTYGNSARVVYSILQGQPYFSVEPKTGVIKTALPNMDREAKDQYLLVIQAKDMVGQNG
GLSGTTSVTVTLTDVNDNPPRFPRRSYQYNVPESLPVASVVARIKAADADIGANAEMEYR
IVDGDGLGIFKISVDKETQEGIITIQKELDFEAKTSYTLRIEAANKDADPRFLSLGPFSD
TTTVKIIVEDVDEPPVFSSPLYPMEVSEATQVGNIIGTVAAHDPDSSNSPVRYSIDRNTD
LERYFNIDANSGVITTAKSLDRETNAVHNITVLAMESQNPSQVGRGYVAITILDINDNAP
EFAMDYETTVCENAQPGQIIQKISAVDKDEPSNGHQFYFSLTTDATNNHNFSLKDNKDNT
ASILTRRNGFRRQEQSVYYLPIFIVDSGSPSLSSTNTLTIRVCDCDADGVAQTCNAEAYV
LPAGLSTGALIAILACVLTLLVLILLIVTMRRRKKEPLIFDEERDIRENIVRYDDEGGGE
EDTEAFDMAALRNLNVIRDTKTRRDVTPEIQFLSRPAFKSIPDNVIFREFIWERLKEADV
DPGAPPYDSLQTYAFEGNGSVAESLSSLDSISSNSDQNYDYLSDWGPRFKRLADMYGTGQ
ESLYS
Download sequence
Identical sequences F6ZW11
9544.ENSMMUP00000000772 NP_001180923.1.72884 XP_001094033.1.72884 XP_014977658.1.72884 ENSMMUP00000000772 ENSMMUP00000000772 ENSMMUP00000041165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]