SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000822 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000000822
Domain Number - Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0131
Family EGF-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000822   Gene: ENSMMUG00000000610   Transcript: ENSMMUT00000000884
Sequence length 259
Comment pep:known chromosome:MMUL_1:20:358739:364565:-1 gene:ENSMMUG00000000610 transcript:ENSMMUT00000000884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPENAEECEQAVVHVETTLYLVPCLNDCGPYGQCLLLRRHSYLYAGCSCKAGWRGWSCT
DNSTAQTVAQQRAAALLLTLSNLMFLAPITVSVQRFFLVEASVYAYTMFFSTFYHACDQP
GEAVLCILNYDTLQYCDFLGSGAAIWVTILCMARLKAVLKYTYRCGHRRQCYPTSWQRWA
FYLLPGISMASVGVAIYTSMMTSDNYYYTHSIWHVLLAGSAALLLPPPDEHAEPWACSQK
FPCHYQICKNDREELYTVT
Download sequence
Identical sequences ENSMMUP00000000822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]