SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000870 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000870
Domain Number 1 Region: 126-218
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.39e-25
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000870   Gene: ENSMMUG00000000646   Transcript: ENSMMUT00000000932
Sequence length 219
Comment pep:known chromosome:MMUL_1:1:28897137:28899461:1 gene:ENSMMUG00000000646 transcript:ENSMMUT00000000932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQTCVRLERASARPSPGPFLPPSLPRHTELQIREGPKRTSRAATEGPCVGRVCAPGHPG
GREGASGARGGVAQAPPRLPAPPIGPERDDLGGAGRKPLPSTAAASSPGSAAATTAALCP
PARTPSMSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALA
GNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
Download sequence
Identical sequences 9544.ENSMMUP00000000870 ENSMMUP00000000870 ENSMMUP00000000870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]