SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000887 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000887
Domain Number 1 Region: 460-579
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 123-217
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-20
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 258-353
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000589
Family Cadherin 0.014
Further Details:      
 
Domain Number 4 Region: 569-678
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000243
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 39-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000228
Family Cadherin 0.012
Further Details:      
 
Domain Number 6 Region: 347-464
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000002
Family Cadherin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000887   Gene: ENSMMUG00000000658   Transcript: ENSMMUT00000000949
Sequence length 859
Comment pep:known_by_projection chromosome:MMUL_1:9:53069019:53092470:-1 gene:ENSMMUG00000000658 transcript:ENSMMUT00000000949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGRWAALALGLLRLCLAQANFAPHFFDNGVGSTNGNMALFSLPEDTPVGSHVYTLNGT
DPEGDPISYHISFDPSARSVFSVDPTFGNITLVEELDREREDEIEAIISISDGLNLVAEK
VVILVTDANDEAPRFIQEPYVALVPEDIPAGSSIFKVHAVDRDTGSGGSVTYFLQNLHSP
FAVDRHSGVLRLQAGATLDYERSRTHYVTVVAKDGGGRLHGADVVGGPCSTATQRPDSFL
GGGSTSFSSRGHCSGCSYFPEGSEVLKVVAMDGDRGKPNRILYSLANGDDGAFEINETSG
AISITQSPAQLQREVYELHVQVTEMSPVGSPVAQATVPVTIRIVDLNNHPPTFYGESGPQ
NRFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQLVGPRGIFRVVPQTVLNEAQVT
IIVENSAAIDFEKSKVLTFKLLAVEVNTPEKFSSTADVVIQLLDTNDNVPKFDSLYYVAR
IPENAPGGSSVVAVTAVDPDTGPWGEVKYSIYGTGADLFLIHPSTGLIYTQPWASLDAEA
TARYNFYVKAEDMEGKYSVAEVFITLLDVNDHPPQFGKSVQKKTMVLGTPVKIEAIDEDA
EEPNNLVDYSITHAEPANVFDINAHTGEIWLKNSIRSLDALHNITPGRDCIWSLEVQAKD
RGSPSFSTTALLKIDITDAETLSRSPMAAFLIQTKDNPMKAVGVLAGTMATVVAITVLIS
TATFWRNKKSNKVLPVRRVVRKRPSPAPRTIRIEWLKSKSAKAATKFMLKEKPPNENCNN
NSPESSLPPRAPALPPPPSVAPSTGAAHWTVPTVSGSLTPQPTQPPPKPKTMGSPIQSTL
ISELKQKFEKKSVHNKAYF
Download sequence
Identical sequences 9544.ENSMMUP00000000887 ENSMMUP00000000887 ENSMMUP00000000887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]