SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000888 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000888
Domain Number 1 Region: 38-254
Classification Level Classification E-value
Superfamily L domain-like 1.31e-31
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Domain Number 2 Region: 251-345
Classification Level Classification E-value
Superfamily Immunoglobulin 1.65e-17
Family I set domains 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000888
Domain Number - Region: 367-433
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000299
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000888   Gene: ENSMMUG00000000659   Transcript: ENSMMUT00000000950
Sequence length 550
Comment pep:known_by_projection chromosome:MMUL_1:9:53060246:53063855:1 gene:ENSMMUG00000000659 transcript:ENSMMUT00000000950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVFHHFLLVLVFLDTHAAQPFCLPGCTCSEESFGRTLQCISVSLGKIPGNLSEEFKQV
RIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNRLCSVPW
TAFRATPLLRVLDLKRNKIDALPELALQFLVSLTYLDLSSNRLTVVSRSVFLNWPAYLKR
RQPDCGAGILSSLVVALHDNPWVCDCRLRGLVQFVKSITLPVILVNSYLICRGPLSKAGQ
LFHETELSTCMKPQISTPSANVTIRVGQNVTLRCLAQASPSPSIAWTYPLSMWREFDVLT
SSTGEDTALSELAIPAAHLVDSGNYTCMASNSIGKSTLVISLHVQPAQALHAPDSLSIPS
EGNAYIDLRVVKQTVHGILLEWLAVADTSEEEWFTLHIASDEAFRKEVVHIGPGINTYAV
DNLLPGTKYKACLSLEDQPPHQGQCVVFVTGRDGGGLEARERLLHVTVVLCVVLLAVPVG
AYAWAAQGPCSCSKWVLCYCLHCRKAPSCPPAAPQCRDGSFREHPAVCDDGEGHIDTEGD
KEKEGMEENS
Download sequence
Identical sequences F6WZB0
9544.ENSMMUP00000000888 ENSMMUP00000000888 ENSMMUP00000000888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]