SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000938 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000938
Domain Number 1 Region: 178-219
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000359
Family Fibrinogen C-terminal domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000938   Gene: ENSMMUG00000000698   Transcript: ENSMMUT00000001000
Sequence length 220
Comment pep:known_by_projection chromosome:MMUL_1:19:8347782:8353122:1 gene:ENSMMUG00000000698 transcript:ENSMMUT00000001000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAPTAGAALMLCVATAVLLRAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAE
RTRSQLNALERRLSACGSACQGTEGSTALPLAPESRVDPEVLHSLQTQLKAQNSRIQQLF
HKVAQQQRHLEKQHLRIQRLQSQVGLLDPKHLDHEVAKPARRKRRPEMAQPVDSAHNASR
LHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTS
Download sequence
Identical sequences ENSMMUP00000000938 ENSMMUP00000000938 9544.ENSMMUP00000000938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]