SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000965 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000965
Domain Number 1 Region: 147-282
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-30
Family Cadherin 0.00022
Further Details:      
 
Domain Number 2 Region: 371-487
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-23
Family Cadherin 0.0082
Further Details:      
 
Domain Number 3 Region: 480-588
Classification Level Classification E-value
Superfamily Cadherin-like 4e-17
Family Cadherin 0.0026
Further Details:      
 
Domain Number 4 Region: 77-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000103
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 261-376
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000799
Family Cadherin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000965   Gene: ENSMMUG00000000712   Transcript: ENSMMUT00000001028
Sequence length 789
Comment pep:known_by_projection chromosome:MMUL_1:6:31326005:31390005:1 gene:ENSMMUG00000000712 transcript:ENSMMUT00000001028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTYRYFLLLFWVGQPYPTLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQF
FLLEEYTGSDYQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREE
KPVYILRAQAINRRTGRPVEPESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQ
VTATDADDPTYGNSAKVVYSILQGQPYFSVESETGIIKTALLNMDRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPXXXXXXXTFTVECKKKN
YILSFLPVPNITLMCFPKQYDSIHLSVIYTKNLLDFEKKKVYTLKVEASNPHVEPRFLYL
GPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVKYSV
DRHTDMDRMFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDV
NDNAPEFAEFYETFVCEKAKADQLIQTLRAVDKDDPYSGHQFSFSLAPEAASGSNFTIQD
NKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCH
AEALIHPTGLSTGALVAILLCIVILLVTVVLFAALRRQRKKEPLIISKEDIRDNIVSYND
EGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPEALFLPRRTPTARDNTDVRDFINQRLK
ENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDGDQDYDYLSDWGPRFKKLADMY
GGVDSDKDS
Download sequence
Identical sequences ENSMMUP00000000965 ENSMMUP00000000965 9544.ENSMMUP00000000965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]