SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001008 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001008
Domain Number 1 Region: 144-262
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.42e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000604
Further Details:      
 
Domain Number 2 Region: 356-486
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.44e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00049
Further Details:      
 
Domain Number 3 Region: 119-167,266-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.56e-21
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001008   Gene: ENSMMUG00000014452   Transcript: ENSMMUT00000001076
Sequence length 493
Comment pep:known_by_projection chromosome:MMUL_1:6:1249759:1284721:-1 gene:ENSMMUG00000014452 transcript:ENSMMUT00000001076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVRRLSRLLSTRRLALAKAWPAVLQTGTRGFHFTVDGNKRASAKVSDSVSSCFLCPTH
AEIIFSVIIINCKYKHKHRLEGCVHTDSTEKMVPGDCYKRSGRGPLCAVTAVCRFHRLRV
HLLLTSTGDSMAMITRADLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERF
MERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISET
AMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASV
HGANRLGANSLLDLVVFGRACALSIEESCRPGDKFPPIKPNAGEESMNLDKLRFADGSVR
TSELRLCMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLE
LQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQKKPFEEHWRKHTL
SYVDVSTGKVSVE
Download sequence
Identical sequences 9544.ENSMMUP00000001008 ENSMMUP00000001008 ENSMMUP00000001008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]