SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001024 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001024
Domain Number 1 Region: 589-806
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.57e-78
Family Fibrinogen C-terminal domain-like 0.00000276
Further Details:      
 
Domain Number 2 Region: 412-574
Classification Level Classification E-value
Superfamily Fibronectin type III 3.25e-19
Family Fibronectin type III 0.0000042
Further Details:      
 
Domain Number 3 Region: 324-411
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-18
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 4 Region: 16-104
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 226-320
Classification Level Classification E-value
Superfamily Fibronectin type III 1.7e-17
Family Fibronectin type III 0.00000215
Further Details:      
 
Domain Number 6 Region: 129-211
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000106
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001024   Gene: ENSMMUG00000000758   Transcript: ENSMMUT00000001092
Sequence length 813
Comment pep:known_by_projection chromosome:MMUL_1:4:31666233:31673003:-1 gene:ENSMMUG00000000758 transcript:ENSMMUT00000001092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPISADGTTASLEKEPPPRLGELTVTEETSSSLHLSWTVAQGPFESFVVQYRDTDGQPR
AVPVAADQHTVTIEDLEPGKKYKFLLYGLVGGKRLGPVSALGMTAPEEDTPAPELAPEAP
EPPEEPRLGVLAVTDTAPDSMRLSWSVAQGPFDSFVVQYEDTNGQPQALLVDGDQSKILI
SGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGPAPAGQTSGEPGPRLSQLSVTDVTTSSL
RLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRDLRPGTLYSL
TLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIRETSAKVNWMPPPSRADSFKVSYQ
LADGGEPQSVQVDGRARTQKLQGLIPGARYEVTVVSVRGFEESEPLTGFLNTVPDGPTQL
RALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPPLQAEAPGSAVDYPLHDLVLHTNYTA
TVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPQVRPTGYLLSFDTPG
GRTQEILLPGGVTSHQLLGLFPSTLYNARLQAMWGESLLPPVSTSFTTGGLRIPFPRDCG
EEMQNGAGASRTTTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAH
GFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFRVDSAAEYYRLHLEG
YHGTAGDSMSYHSGSVFSARDRDPNNLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQ
GVSWYYWKGFEFSVPFTEMKLRPRNFRSPAGGG
Download sequence
Identical sequences 9544.ENSMMUP00000001024 ENSMMUP00000001024 ENSMMUP00000001024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]