SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001047 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001047
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.44e-70
Family Calponin-homology domain, CH-domain 0.0000071
Further Details:      
 
Domain Number 2 Region: 4456-4615
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-28
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 267-383
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 4282-4399
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 4695-4832
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 3797-3956
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 4038-4178
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-24
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 3254-3411
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 4128-4278
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-23
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 4828-4943
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 2818-2972
Classification Level Classification E-value
Superfamily Spectrin repeat 6.38e-21
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 12 Region: 2017-2175
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 13 Region: 5163-5242
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.37e-20
Family GAS2 domain 0.00053
Further Details:      
 
Domain Number 14 Region: 4618-4727
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-20
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 15 Region: 2485-2611
Classification Level Classification E-value
Superfamily Spectrin repeat 7.28e-19
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 16 Region: 3690-3837
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-18
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 17 Region: 3031-3191
Classification Level Classification E-value
Superfamily Spectrin repeat 2.54e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 18 Region: 701-803
Classification Level Classification E-value
Superfamily Spectrin repeat 2.73e-16
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 19 Region: 1236-1364,1391-1419
Classification Level Classification E-value
Superfamily Spectrin repeat 2.96e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 20 Region: 3406-3523
Classification Level Classification E-value
Superfamily Spectrin repeat 4.17e-16
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 21 Region: 5074-5154
Classification Level Classification E-value
Superfamily EF-hand 8.84e-16
Family Polcalcin 0.044
Further Details:      
 
Domain Number 22 Region: 3472-3622
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000023
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 23 Region: 2706-2828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000835
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 24 Region: 3954-4067
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 25 Region: 1788-1909
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000035
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 26 Region: 1925-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000054
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 27 Region: 2234-2354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000103
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 28 Region: 2393-2502
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000012
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 2618-2719
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000013
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 30 Region: 776-883,1004-1024
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000216
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 31 Region: 608-700
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000131
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 32 Region: 4953-5014
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000619
Family Spectrin repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001047
Domain Number - Region: 1555-1667
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00144
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 1068-1172
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0111
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001047   Gene: ENSMMUG00000000777   Transcript: ENSMMUT00000001118
Sequence length 5457
Comment pep:known chromosome:MMUL_1:4:56099748:56473567:-1 gene:ENSMMUG00000000777 transcript:ENSMMUT00000001118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQLKLCSLEYRKISR
KNRRVSLRFICTVLSRVCISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIAHRVQRDSVICEDKLILARNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNEC
SSVYSKGRMLTTEQTKLVISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGSVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVEEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTATLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNVARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYR
AAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSI
HKLEDLVQESMEEKEELLQYKSTIASLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQ
NVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFL
EDSQESQIFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAAS
SSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEA
VIADKNNIENLISTLKQWRSEVDEKRQVFHALQDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQ
PENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQ
KSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSMQKISSEEISTKKEQLSETLQAMQLFLA
KHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKIVAERQQEYK
EKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKN
TENFLKENGEKLSREDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKV
AAVKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEV
NGNLLETDVDGQVGPTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLS
PEEKEKLQKNMKELKAHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQEL
ENLEAGADDLNGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGQVD
TSATHREVQHKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLSGLQACEAT
ASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKND
IQKTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGSVESSLKEQGQV
PLNSAALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQARMKDLSAR
FSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYM
QESTSEFLEHKKDLEVLHSLLKEISSHGLPSDKALVFEKTNNLSKKFKEMEDTIKEKKEA
VTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTP
EIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAILNGEGTATNTEEFWANKGLTSIKKD
MTDISHDYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWHQTPAPT
DTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKW
QELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQ
QVQILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLHGIVKEQLAAVTQKWDSLTGQLSD
RCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEI
QQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDIEQKAESHVQHLQSACA
SSHQFQQMSRDFQAWLDTKKEEQNKSHPISAKLNVLESLIKDHKDFSKTLTAQSHIYEKT
IAEGENLLLKTQGSEKAALQLQLNTIKTSWDTFNKQVKERENKLKDSLEKALKYKEQVET
LRPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCE
IDKEVVTDENKSLIQKVDMVTEQLHSKKFSLENMAQKFKEFQEVSKESKRQLHCAKEQLD
IYDSLGPQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQAE
TIAQEHSALSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAET
LQKQKETIKAFLKKLEALIASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLL
DRAQAREEQVEGTIKRLEEFYSKLKEFSTLLQKAEEHEESQGPVGMETETINQQLEVFKV
FQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQ
LQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRK
STVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQF
HETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQISQHKALEDDIINHNKHLHQAVSIGQ
SLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWL
NEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEV
LIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYE
TQVLKGEAASQAQVRQKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDN
ERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSA
QLQVQKTFTMEILRHKDIIDELVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINS
ERYLQLERAQSLVNQFWETYEELWPWLTETQSVISQLPAPALEYETLRQQQEEHRQLREL
IAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQ
STQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLK
QRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCD
HMSLVVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQEELDIVINLGSELI
AACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIA
GGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHT
VQDPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLTWLTHTEGLLSEQKPV
GGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGERSSNLQKQLQVLNPR
WQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQL
NVHMEVCAAFEAKEETYKSLMQKGQHMLARCPKSAETNIDQDINNLKEKWESVETKLNER
KTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVN
SHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRA
KQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNR
TGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQAL
IDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSR
DDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLR
FHGVLPDDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWIT
IIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEI
EEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPA
SSLYPSGSQTQIETKNPRVNLLLREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQ
DGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPIT
DADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRVSFQNNFGDSQQLRLVRILRSTVMVRV
GGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADG
ASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAATPQVPATTTPKGTPIQGSKLRL
PGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDAS
DFDISEIQSVCSDVETVPQTHRPTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences ENSMMUP00000001047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]