SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001079 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001079
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-70
Family Calponin-homology domain, CH-domain 0.0000071
Further Details:      
 
Domain Number 2 Region: 2780-3022
Classification Level Classification E-value
Superfamily Plakin repeat 1.13e-65
Family Plakin repeat 0.00000973
Further Details:      
 
Domain Number 3 Region: 2476-2710
Classification Level Classification E-value
Superfamily Plakin repeat 1.44e-62
Family Plakin repeat 0.00000351
Further Details:      
 
Domain Number 4 Region: 267-383
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 1281-1409,1436-1464
Classification Level Classification E-value
Superfamily Spectrin repeat 1.29e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 710-823
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 7 Region: 608-658
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000275
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 8 Region: 801-903,1030-1050
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000576
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001079
Domain Number - Region: 2047-2242
Classification Level Classification E-value
Superfamily Tropomyosin 0.000108
Family Tropomyosin 0.0049
Further Details:      
 
Domain Number - Region: 2725-2771
Classification Level Classification E-value
Superfamily Plakin repeat 0.00149
Family Plakin repeat 0.019
Further Details:      
 
Domain Number - Region: 1094-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0576
Family Spectrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001079   Gene: ENSMMUG00000000777   Transcript: ENSMMUT00000001150
Sequence length 3036
Comment pep:known chromosome:MMUL_1:4:56249472:56473567:-1 gene:ENSMMUG00000000777 transcript:ENSMMUT00000001150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQLKLCSLEYRKISR
KNRRVSLRFICTVLSRVCISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIAHRVQRDSVICEDKLILARNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNEC
SSVYSKGRMLTTEQTKLVISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGSVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVEEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTATLKLTYAEKLHRLESQYAKLLVSFFFLKPSNTSRNQERHLDTLHNFVSRATNE
LIWLNEKEEEEVAYDWSERNTNVARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHP
ARLTIEVLDSVMFLVHYAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDY
LRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIASLMGKAKTIIQLKPR
NSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFT
VPPPNKEAVDFANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASVSVN
LYIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQIFSGSDITQLEKEVNVCKQYYQELLKS
AEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKK
ELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDNFMVN
VSVFQGGYCLISFLRLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTL
KQWRSEVDEKRQVFHALQDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNVH
VQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQK
MLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADL
IIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEVIINSEQPVNIKELETSKMCKET
SEHGAYSDLLQRQKATVLENSKLTGKISELERMVAELKKQKSRVEEELPKVREAAENELR
KQQRNVEDISLQKIRAESEAKQYRRELETIVREKEAAERELERVRQLTIEAEAKRAAVEE
NLLNFRNQLEENTFTRRTLEDHLKRKDLSLNDLEQQKNKLTEELRRKRDNEEELLKLIKQ
MEKDFAFQKQVAEKQLKEKQRIELEARRKITEIQYTCRENALPVCAITQATSCRAVTGLQ
QEHDKQKAEELKQQVDELTAANRKAEQDMRELTYELNALQLEKTSSEEKARLLKDKLDET
NNTLRCLKLELERKDQAEKGYSQQLRELGRQLNQTTGKAEEAMQEANDLKKIKHNYQLEL
ESLHHEKGKLQREVDRITRAHAVAEKSIQHLNSQIHSFRDEKELERLRICQRKSDHLKEQ
FEKSHEQLLKNIKAEKENNDKIQRLNEELEKSNECAEMLKQKVEELTRQNNETKLMMRRI
QAESENVVLEKQTIQQRCEALKIQADGFKDQLRSTNEHLHKQTKTEQDFQRKIKCLEEDL
AKSQNLVSEFKQKCDQQNIIIQNTEKEVRNLNAELSASKEEKRRGEQKVQLQQAQVQELN
NRLKKVQDELHLKTIEEQMTHRKMVLFQEESDKFKQSAEEFRKKMEKLMESKVITENDIS
GIKLDFVSLQQENCRAQENAKLCETNIKELERQLQQYREQMQQGQHVEANHYQKCRKLED
ELIAQKCEVENLKQKMDQQIKEHEHQLVLLQCEIKKKNTAKDCTFKPDFEMTVKECQHSG
ELSSRNTGHLHPTPRSPLLRWTQEPQPLEEKWQHQVVEQIPKEVQFQPPGAPLEKEKSQQ
CYSEYFSQTSTELQITFDETNPITRLSEIEKIRDQALNNSRPPVRYQDNAREMELVKLLT
PLEIAKNKQYDMHTEVTTLKQEKNPVPSAEEWMLEGCRASGGLKKGDFLKKGLEPEIFQN
FDGDHACSVRDDEFKFQGLRHTVTARQLVEAKLLDMRTIEQLRLGLKTVEEVQKTLNKFL
TKATSIAGLYLESTKEKISFASAAKRIIIDKMMALAFLEAQAATGFIIDPISGQIYSVED
AVLKGVVDPEFRIRLLEAEKAAVGYSYSSKTLSVFQAMENRMLDRQKGKHILEAQIASGG
VIDPVRGIRVPPEIALQQGLLNNAILQFLHEPSSNTRVFLNPNNKQALYYSELLQMCVFD
VESQCFLFPFGERNISNLNVQKTHRISVVDTKTGSELTAYEAFQRNLIEKSIYLELSGQQ
YQWKEATFFESYGHSSHMLTDTKTGLNFNINEAIEQGTIDKALVKKYQEGLITLTELADT
LLSRLVPKKDLNSPIAGYWLTASGERISVLKASRRNLVDRITALRCLEAQVSTGGIIDPL
TGKKYRVAEALHRGLVDEGFAQQLRQCELVITGIGHPITNKMMSVVEAVNANIINKEMGI
RCLEFQYLTGGLIEPQGHSRLSIEEALQVGIIDVLIATKLKDQKSYIRNIICPQTKRKLT
YKEALEKADFDFHTGLKLLEVSEPLMTGISSLYYSS
Download sequence
Identical sequences ENSMMUP00000001079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]