SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001096 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001096
Domain Number 1 Region: 317-567
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.41e-90
Family STAT DNA-binding domain 0.000000559
Further Details:      
 
Domain Number 2 Region: 139-316
Classification Level Classification E-value
Superfamily STAT 3.92e-44
Family STAT 0.00015
Further Details:      
 
Domain Number 3 Region: 568-686
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-40
Family SH2 domain 0.0000253
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.75e-33
Family Transcription factor STAT-4 N-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001096   Gene: ENSMMUG00000000803   Transcript: ENSMMUT00000001167
Sequence length 851
Comment pep:known chromosome:MMUL_1:11:53420730:53438659:-1 gene:ENSMMUG00000000803 transcript:ENSMMUT00000001167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDSPFQDQLHQLYSCSLLPVDIRQYLAVWIEDQNWQEAVLGNDDSKATMLF
FHFLHQLNYECGRCSQDPDSLLLKHNLRKFCRDIQAFSQGPTQLAEMIFNLLLEEKRILI
QAQRAQPEQGEPALVTPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFSFRYKIQ
AKGKTPSLDSHQAKEQQILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLEKWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLIKGVDLR
NAQVTELLQRLLDRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPLKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTISGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKLEPELES
LELELGLAPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVMEPTLCMVSQTVPEPDRG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEAYVSRPSHF
YTDGPLMPSDF
Download sequence
Identical sequences F6R1P6 G7PIH9
NP_001253856.1.72884 XP_015007452.1.72884 XP_015007453.1.72884 9544.ENSMMUP00000001096 ENSMMUP00000001096 ENSMMUP00000001096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]