SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001146 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000001146
Domain Number - Region: 50-79
Classification Level Classification E-value
Superfamily Fibronectin type III 0.016
Family Fibronectin type III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001146   Gene: ENSMMUG00000000851   Transcript: ENSMMUT00000001220
Sequence length 226
Comment pep:known chromosome:MMUL_1:2:180038829:180043198:-1 gene:ENSMMUG00000000851 transcript:ENSMMUT00000001220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTSLTTCEWKKVFYEKMEVAKPADSWELIIDPNLKPSELAPGWKQYVEQHASGRFHCSW
CWHTWQSAHVVILFHMHLDRARRMGSVRMRVFKQLCYECGTARQDESSMLEENIEGLVDN
LITSLREQCYEEDGGQYRIHVASRPDNRPHRTEFCEACQEGIVHWKPSEKLLEEEATAYT
FSEASKPRAQAGSGYNFLSLRWCLFWASLCLLAVYLQFSFRSPAFL
Download sequence
Identical sequences F6TGC4
9544.ENSMMUP00000001146 ENSMMUP00000001146 ENSMMUP00000001146 XP_001103946.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]