SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001255 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001255
Domain Number 1 Region: 34-391
Classification Level Classification E-value
Superfamily L domain-like 5.21e-61
Family Ngr ectodomain-like 0.056
Further Details:      
 
Domain Number 2 Region: 428-516
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 527-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000039
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001255   Gene: ENSMMUG00000000938   Transcript: ENSMMUT00000001336
Sequence length 716
Comment pep:known chromosome:MMUL_1:2:57161589:57206129:-1 gene:ENSMMUG00000000938 transcript:ENSMMUT00000001336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMSFVVAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCND
LRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQ
LTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISANAFAGLKNLLRLHLNSNKLK
VIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLVNLRSLVLAGMYLTDIPGNALVGLDS
LESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGEL
VSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESL
PNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE
QCLPMISHDTFPNRLNMDIGMTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSS
EGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSIL
VSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSN
IHQQTQKSCVNVTTKNAAFALDISDQETSTALAAVMGSMFAVISLASIAVYFAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW
Download sequence
Identical sequences A0A096MN28 A0A0D9SBT6 A0A2K5L3J7 A0A2K5XQ98 A0A2K6B026 F6R6D9 G7NYW8
9544.ENSMMUP00000001255 ENSMMUP00000001255 ENSPANP00000001019 NP_001181062.1.72884 XP_005547716.1.63531 XP_007983242.1.81039 XP_011732467.1.29376 XP_011732468.1.29376 XP_011852208.1.47321 XP_011852209.1.47321 XP_011915329.1.92194 XP_011915330.1.92194 XP_014985840.1.72884 XP_015301690.1.63531 ENSMMUP00000001255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]