SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001273 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001273
Domain Number 1 Region: 19-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-22
Family G proteins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001273   Gene: ENSMMUG00000000948   Transcript: ENSMMUT00000001355
Sequence length 204
Comment pep:known_by_projection chromosome:MMUL_1:11:18456868:18466059:-1 gene:ENSMMUG00000000948 transcript:ENSMMUT00000001355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNFWHLKYEKSVSVTKALTVRFLTKRFIGEYASNFESIYNKHLCLERKQLNLEIYDPCS
QTQKAKFSLTSELHWADGFVIVYDISDRSSFAFAKALIYRIRDPQTSHCKRAVESAMFLV
GNKRDLCHVREVGWEEGQKLALDNRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEK
RRPSGSKSMAKLINNVFGKRRKSV
Download sequence
Identical sequences 9544.ENSMMUP00000001273 ENSMMUP00000001273 ENSMMUP00000001273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]