SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001393 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001393
Domain Number 1 Region: 161-424
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.33e-36
Family Eukaryotic proteases 0.0005
Further Details:      
 
Domain Number 2 Region: 67-128
Classification Level Classification E-value
Superfamily GLA-domain 6.9e-23
Family GLA-domain 0.0005
Further Details:      
 
Domain Number 3 Region: 117-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001393   Gene: ENSMMUG00000001039   Transcript: ENSMMUT00000001482
Sequence length 424
Comment pep:known chromosome:MMUL_1:17:93271906:93286006:1 gene:ENSMMUG00000001039 transcript:ENSMMUT00000001482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCIPLLQGLVLVLALQRAEPSGRRLAYLHGLHPDSACTGVQESCKLFLPASKANDVLA
RWKRAGSYLLEELFEGNLEKECYEEICTYEEAREVFENEVVTDEFWRRYKGGSPCISQPC
LHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGY
RLGEDRKQCVPHDQCACGVLTSEKRALDLQDLPWQVKLTNAEGKDFCGGVIIQENFVLTT
ARCSLLHRNISVKTYFNRTSQDPLMIKIMRAHVHMWYDADTGENDLSLLELEWPIQCPDA
GLPVCTPENDFAEHLLIPRTGGLLSGWARNGTDLGNSLTTLPVTLVEGEECGQVLNVTVT
TRTYCERSSVAAVHWMEGSVVTREHRGSWFLTGVLGSQPAGGQARMVLVTKVSRYSLWFK
WIMN
Download sequence
Identical sequences G7NJN3
ENSMMUP00000001393 9544.ENSMMUP00000001393 ENSMMUP00000001394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]