SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001571 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001571
Domain Number 1 Region: 42-420
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.81e-121
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.000000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001571   Gene: ENSMMUG00000001179   Transcript: ENSMMUT00000001667
Sequence length 421
Comment pep:known chromosome:MMUL_1:11:54670639:54683016:1 gene:ENSMMUG00000001179 transcript:ENSMMUT00000001667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSVPPATVQAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLMGVFLWGVAHSIN
ELSQVPLPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDIDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEG
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A
Download sequence
Identical sequences F6R9Q5 G7PIV8
ENSMMUP00000001570 ENSMMUP00000001571 NP_001248083.1.72884 XP_005571423.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]