SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001626 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001626
Domain Number 1 Region: 20-80
Classification Level Classification E-value
Superfamily Caspase-like 1.5e-18
Family Caspase catalytic domain 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001626   Gene: ENSMMUG00000001217   Transcript: ENSMMUT00000001725
Sequence length 184
Comment pep:known chromosome:MMUL_1:9:113383348:113388376:1 gene:ENSMMUG00000001217 transcript:ENSMMUT00000001725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKKKKNVSGQSIKTTRDRVPTYQYNMNFEKMGKCIIINNKNFDKVTGMGVRNGTDKDAEA
LFKCFQSLGFDVIVHNDCSLVTHAGVQRCNLGSLKPPPPGFKQFSSLSLPSSWDYRHAPP
CLANFCIFRRGFRHADQAGLKLLASSDPPTSGFQSAGITGVSLHTQPQIMKVSLRHCNTF
ICFA
Download sequence
Identical sequences ENSMMUP00000001626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]