SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001668 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001668
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.14e-117
Family Transglutaminase core 0.0000000000106
Further Details:      
 
Domain Number 2 Region: 9-191
Classification Level Classification E-value
Superfamily E set domains 6.3e-58
Family Transglutaminase N-terminal domain 0.00000000853
Further Details:      
 
Domain Number 3 Region: 518-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-31
Family Transglutaminase, two C-terminal domains 0.00000107
Further Details:      
 
Domain Number 4 Region: 630-728
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-28
Family Transglutaminase, two C-terminal domains 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001668   Gene: ENSMMUG00000001248   Transcript: ENSMMUT00000001770
Sequence length 732
Comment pep:known chromosome:MMUL_1:4:6045210:6204249:-1 gene:ENSMMUG00000001248 transcript:ENSMMUT00000001770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSRIAFGGRRAVPPNNSNAAEDDLPTLELQGVVPRGVNLQEFLNVTSIHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYIQIDFNRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMREDRSVRLSVQSSPECIVGKFRMYVAVWTPYGIIRTSRNPETD
TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYQSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSKVDMDFEVENAVLGKDLKLTITF
RNNSHNHYTITAYLSANITFYTGVSKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPKLIIKVRGAQVVGSDMIVTVEFTNPLKET
LRNVWIHLDGPGITRPMRKMFREIRPNSTVQWEEVCRPWVSGPRKLIASMSSDSLRHVYG
ELDVQIQRRPSM
Download sequence
Identical sequences F7D3L5 G7P4C8
9544.ENSMMUP00000001668 XP_001096779.2.72884 XP_014990996.1.72884 ENSMMUP00000001668 ENSMMUP00000001668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]