SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001749 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001749
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-23
Family Calponin-homology domain, CH-domain 0.0013
Further Details:      
 
Domain Number 2 Region: 935-1053
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000453
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001749   Gene: ENSMMUG00000001312   Transcript: ENSMMUT00000001854
Sequence length 1541
Comment pep:known_by_projection chromosome:MMUL_1:17:56167009:56309737:1 gene:ENSMMUG00000001312 transcript:ENSMMUT00000001854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAVTEKNFETKDFRASLENGVLLCDLINKLKPGVIKKINRLSTPIAGLDNINVFLKACEQ
IGLKEAQLFHPGDLQDLSNRVTVKQEETDRRVKNVLITLYWLGRKAQSNPYYNGPHLNLK
AFENLLGQALTKALEDSSFLKRSGRDSGYGDIWCPERGEFLAPPRHHKREDSFESLDSLG
SRSLTSCSSDITLRGGREGFESDTDLEFTFKMQDYNKDDMSYRRISAVEPKTALPFNRFL
PNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEADGTFSSNQRRIWGTNVENWPTVQ
EASKSSCYLEEEKAKTRSIPNIVKDDLYVRKLTPVMPNPGNAFDQFLPKCWIPEDVNWKR
IKRETYKPWYKEFQGFSQFLLLQALQTYSDDILSSETHTKIDPTSGPRLITRRKNLSYAP
GYRRDDLEMAALDPDLENDDFFVRKTGAFHANPYVLRAFEDFRKFSEQDDSVERDIILQC
REGELVLPDLEKDDMIVRRIPAQKKEVPLSGAPDRYHPVPFPEPWTLPPEIQAKFLCVLE
RTCPSKEKSNSCRILVPSYRQKKDDMLTRKIQSWKLGTAVPPVSFTPGPCSEADLQRWEA
IREASRLRHKKRLMVERLFQKIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQ
DQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSERSSKTFKEMLQDRESQNQK
STVPSRRRMYSFDDVLDEEKRPPTLTVSEASYRSERVEEKGTTYPSEILKEDSTTFAKRE
NSVTTEIQLPSQSPVEEQRPTSLSSLRSLSTQMESTRVSASLPRSYQKTDTVRLTSVVTP
RPFGSQTRGISSLPRSYTVKNVLSSFISISKIANASTNCKGESHHSPDLTCQLASSSFSQ
REVAATEEDATRQPSPTSPFSSLSQGQAATSKATLSSTSGLDLMSESGEGEISPQREVSR
SQDQFSDMRISINQTPGKSLDFGFTIKWDIPGIFVASVEAGSPAEFSQLQVDDEIIAINN
TKFSYKDSKEWEEAMAKAQETGHLVMDVRRYGKAGSPETKWIDATSGIYNSEKSSNLSIT
TDFSESLQSSNIESKEINGIHDESNAFESKASESISLKNLKRRSQFFEQGSSDSVVPDLP
VPTISAPSRWVWDQEEERKRQERWQKEQDRLLQEKYQREQEKLREEWQRAKQEAERENSK
YLDEELMVLSSNSMSVTTREPSPATWEATWSEGSKSSDREGTRAGEEDRRQPQEEVVHED
QGKKPQDQLVIERERKREQELQEEQEQKRLQAETEEQKRPAEEQKHQAEIERETSVRIYQ
YRRPIDSYDIPKREEASSGFLPNDRNKSRSTTELDDYSTNKNGSNKYLDRIGNTTSSQRS
SKKEQVPSGAELERQQILQEMRKRTPLHNDNSWIRQRSASVNKEPVSLPGIMRRGESLDN
LDSPRSNSWRQPPWLNQPTGFYASSSVQDFSRPPPQLVSTSNRPYMRNPSSSVPPPSAGP
VKTSTTGVATAQSPTPRSHSPSTSQSGSQLRNSWTANRHVM
Download sequence
Identical sequences ENSMMUP00000001749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]