SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001808 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001808
Domain Number 1 Region: 55-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.95e-64
Family NQO2-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001808   Gene: ENSMMUG00000001354   Transcript: ENSMMUT00000001915
Sequence length 249
Comment pep:novel chromosome:MMUL_1:11:98605753:98606502:-1 gene:ENSMMUG00000001354 transcript:ENSMMUT00000001915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLGNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL
Download sequence
Identical sequences ENSMMUP00000001808 ENSMMUP00000001808 9544.ENSMMUP00000001808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]