SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001817 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000001817
Domain Number - Region: 3113-3182
Classification Level Classification E-value
Superfamily WWE domain 0.00115
Family WWE domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001817   Gene: ENSMMUG00000001362   Transcript: ENSMMUT00000001926
Sequence length 3753
Comment pep:known_by_projection chromosome:MMUL_1:7:40265538:40452445:-1 gene:ENSMMUG00000001362 transcript:ENSMMUT00000001926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGGNVALDNLQIKENALSELDVPFKVKAG
QIDKLTLKIPWKNLYGEAVVATLEGLYLLVVPGASIKYDAEKEEKSLQDVKQKELSRIEE
ALQKAAEKGTHSGEFIYGLENFVYKDIKPGRKRKKHKKHFKKPFKGLDHSKDKPKEAKKD
TFVEKLATQVIKNVQVKITDIHIKYEDDVTDPKRPLSFGVTLGELSLLTANEHWTPCILN
ETDKIIYKLIRLDSLSAYWNVNCSMSYQRSREQILDQLKNEILTSGNIPPNYQYIFQPIS
ASAKLYMNPYAESELKTPKLDWNIEIQNIAIELTKPQYLSMIDLLESVDYMVRNAPYRKY
KPYLPLHTNGRRWWKYAIDSVLEVHIRRYTQMWSWSNIKKHRQLLKSYKIAYKNKLTQSK
VSEEIQKEIQDLEKTLDVFNIILARQQAQVEVIRSGQKLRKKSADTGEKRGGWFSGFWGK
KESKKKDEESLIPESIDDLMTPEEKDKLFTAIGYSESTHNLTLPKQYVAHIMTLKLVSTS
VTIRENKNIPEILKIQIIGLGTQVFQRPGAQALKVEAKLEHWYITGLRQQDIVPSLVASI
GDTTSSLLKIKFETNPEDSPADQTLIVQSQPVEVIYDAKTVNAVVEFFQSNKGLDLEQIT
SATLMKLEEIKERTATGLTHIIETRKVLDLRINLKPSYLVVPQTGFHHEKSDLLILDFGT
FQLNSKDQGLQKTTNSSLEEIMDKAYDKFDVEIKNVQLLFARAEENWKKCRFQHPSTMHI
LQPMDIHVELAKAMVEKDIRMARFKVSGGLPLMHVRISDQKMKDVLYLMNSIPLPQKSSA
QSPEKQVSSIPVISGGTKGLLGTSLLLDAVESESDDEYFDAEDGEPQTGKSMKGSELKKA
AEVPNEELINLLLKFEIKEVILEFTKQQKEEDTILVFNVTQLGTEATVRTFDLTAVSYLK
KISLDYHEIEGSKKKPLHLISSSDKPGLDLLKVEYIKADKNGPSFQTTFGKTEQTVKVAF
SSLNLLLQTQALVSSINYLTTIIPSDDQSINVAKEVQISTEKQQKNSTLPKVIVSSKDSD
IIGFRLFAQLNAFCVVVCNEKNNIAEIKIQGLDSSLSLQSRKQSLFARLENIIVTDVDPK
TVHKKAVSIMGNEVFRFNLDLYPNATEGDLYTDMSKVDGVLSLNVGCIQIVYLHKFLMSL
LNFLSNFQTAKESLSAATAQAAEKAATSVKDLAQRSFRVSINIDLKAPVIVIPQSSISTN
AVVVDLGLIRVQNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGTYHPDIQLLHP
INLEFLVNRNLAASWYHKMPVVEIKGHLDSMNVSLNQEDLNLLFRILAENLGEGTEDLDK
VKPRVQETGETKEPLEISISQQNMHDSKNTLTTGVEEIRSVDIINMLLNFEIKEVVVTLM
KKSEKKGRPLHELNVLQLGMEARVKTYDMTAKAYLKKISMQCFDFTDSKGEPLHIINSSN
VTDEPLLKMLLTKADSDGPEFKTIHDSTKQTLKVSFSSLDLVLHLEALLSFMDFLSSAAP
FSEPSSSEKESELKPLVEESRSIAVKSVSSNISQKDVFDLKVTAELNAFNVLVCDQKCNI
AEIKIHGMDASISVKPKQTDVFARLKDIIVTNVDLQSIHKKAVSILGDEVFRFQLTLYPD
ATEGKAYADMSKVDGKLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVQAAER
AASSMKDLAQKSFRLLMDINLKAPVIIIPQSSVSPNAVIADLGLIRIENKFSLVPMEHYS
LPPVIDKMNIELTQLKLSRTILQASLPQNDTEILKPVNMLLSIQRNLAAAWYVQIPGMEI
KGKLKPMQVALSEDDLTVLMKILLENLGEASSQPSPTQSVQEAVRVRKVDVSSGPDHLKE
QEDWTDSKLSMNQTVSLQFDFHFESLSIILYNNDINQESGVTFHNDSFQLGELRLHLMAS
SGKMFKDGSMNVSVKLKTCTDDLREGIERATSRMIDRKNDQDNNSSMIDLSYKQDKNGSQ
IDAILDKLYVCASVEFLMTVADFFIKAVPQSPENVAKETQILPRQTATGKVKTEKDDSVR
PNMTLKAMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLEQMMEASVRDLKVLACP
FLREKRGKNITTVLQPCSLFMEKCMWASGKQNINIMVKEFIIKISPIILNTVMTIMAALS
PKTKEDESKDTSKEMENLWGVKSINDYNTWFLGVDMATEVTESFKDIEHSLIEENCGVVV
ESIQVTLECGLGHRTVPLLLAESKFSGNIKNWTSLMAATADVTLQVHYYNEIHAVWEPLI
ERVEGKRQWNLRLHVKKNPVQDKSLLPGDDFIPEPQMAIHISSGNTMNITISKSCLNIFN
NLAKGFSEGTASTFDYSLKDRAPFTVKNAVGVPIKVKPNCNLRVMGFPEKSDIFDVDAGQ
NLELEYASMVPSSQGNLSILSRQESSFFTLTIVPHGYTEVANIPVARPGRRLYNVRNPNA
SHSDSVLVQIDATEGNKVITLRSPLQIKNHFSIAFIIYKFVKNVKLLERIGIARPEEEFH
VPLDSYRCQLFIQPAGILEHQYKESTTYISWKEELHRSREVRCMLQCPSVEVSFLPLIVN
TVALPDELSYICTHGEDWDVAYIIHLYPSLTLRNLLPYSLRYLLEGTAETHELAEGSTAD
VLHSRISGEIMELVLMKYQGKNWNGHFRIRDTLPEFFPVCFSSDSTEVTTVDLSVHVRRI
GSRMVLSVFSPYWLINKTSRVLQYRSEDTHVKHPADFRDIILFSFKKKNIFTKNKVQLKI
STSAWSSSFSLDTVGSYGCVKCPANNMEYLVGVSIKMSSFNLSRIVTLTPFCTIANKSSL
ELEVGEIASDGSMPTNKWNYIASSECLPFWPENLSGKLCVRVVGCEGSSKPFFYNRQDNG
TLLSLEDLNGGILVDVNTAEHSTVITFSDYHEGSAPALIMNHTPWDILTYKQSGSPEEMV
LLPRQARLFAWADPTGTRKLTWTYAANVGEHDLLKDECGQFPYDANIQIHWVSFLDGRQR
VLLFTDDVALVSKALQAEEMEQADYEINLSLHSLGLSLVNNESKQEVSYIGITSSGVVWE
MKPKRKWKPFSQKQIILLEQSYQKHQISRDHGWIKLDNNFEVNFDKDPMEMRLPIRCPIK
RDFLSGIQIEFKQSSHQRSLRARLYWLQVDNQLPGAMFPVVFHPVAPPKSIALDSEPKPF
IDVSVITRFNEYSKVLQFKYFMVLIQEMALKIDQGFLGAVIVLFTPTTDPEAERKRTKLI
QPDIDALNAELMETSMTDMSILSFFEHFHISPVKLHLSLSLGSGGEGSDKEKQEMFAVQS
VNLLLKSIGATLTDVDDLIFKLAYYEIQYQFYKRDQLMWSVVRHYSEQFLKQMYVLVLGL
DVLGNPFGLIRGLSEGVEALFYEPFQGAVQGPEEFAEGLVIGVRSLFGHTVGGAAGVVSR
ITGSVGKGLAAITMDKEYQQKRREELSRQPKDFGDSLARGGKGFLRGVVGGVTGIITKPV
EGAKKEGAAGFFKGIGKGLVGAVARPTGGIIDMASSTFQGIQRAAESTEEVSSLRPPRLI
HEDGIIRPYDRQESEGSDLLENHIKKLEGETYRYHCAIPGSKKTILMVTNRRVLCIKEVE
ILGLMCVDWQCPFEDFVFPPSVSENVLKISVKEQGLFHKKDSASQGCVRKVYLKDTTTAE
RARNAIEDAQSTRQQQKLMKQSSVRLLRPQMPS
Download sequence
Identical sequences ENSMMUP00000001817 9544.ENSMMUP00000001817 ENSMMUP00000001818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]