SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001839 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001839
Domain Number 1 Region: 1748-1884
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.04e-26
Family Gelsolin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 2146-2209
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 2.09e-20
Family VHP, Villin headpiece domain 0.00053
Further Details:      
 
Domain Number 3 Region: 1869-1984
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.44e-18
Family Gelsolin-like 0.0043
Further Details:      
 
Domain Number 4 Region: 1433-1545
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.31e-17
Family Gelsolin-like 0.0014
Further Details:      
 
Domain Number 5 Region: 1966-2117
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.96e-17
Family Gelsolin-like 0.0046
Further Details:      
 
Domain Number 6 Region: 1581-1623,1651-1693
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000561
Family Gelsolin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001839   Gene: ENSMMUG00000001374   Transcript: ENSMMUT00000001952
Sequence length 2209
Comment pep:known chromosome:MMUL_1:9:29599116:29692280:-1 gene:ENSMMUG00000001374 transcript:ENSMMUT00000001952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRKERIARRLEGIENDTQPILLQSCTGLVTHRLLEEDTPRYMRASDPASPHIGRSNEEEE
TSDSSLEKQTQSKYCTESSGVHGDSPYGSGTMDTHSLESKAERIARYKAERRRQLAEKYG
LTLDPEADSEYLSRYTKSRKEPDAVEKRGGKSDKQEESSRDASSPYPRTETMGLRTCAGE
SKDYALRGGDGASDPEVLLNVENQRRGQELSATRQAHDLSPAAESSSTFSLSGRDSSFTE
VPRSPKHMHSSSLQQAASRSPSFGDPQLSPEARPSTGKPKHEWFLQKDSEGDTPSLINWP
SRVKVREKLVKEESARNSPELASESITQRRHQPAPVHYLSFQSEHSAFDRVPSKAAGSAR
RPIRGYVQPADTGHTAKLVTPETPENVSECSWVASATQNVPKPPPLKVLEGDGRDSPVLH
ICESKAEEEGGGEEKEEEDVLFTEALEQSKKTLLALEGDGLVRSPEDPSRNEDFGKPAVS
TVTSEHQKEPESMAHPPQAQHQPTERTGRSEMVLYIQSEPVSQDAKPTGHNKEASKKRKV
RTRSLSDFTGPPQLQALKYTDPASRRELELPSSKTEGPYGELSMLDTKVSVAQLRSAFLA
SANACRRPELKSRVERSAEGPGLPTSVERERGSRKPRRYFSPGESRKTSERFRTQPVTSA
ERKESDRCTSHSEMPAIDEEKVDERAKLSVAAKRLLFREMEKSFDEQNVPKRRSRNAAVE
QRLRRLQDRSLTQPITTEEVVIAATEPIPASCSGGTHPVMARLPSPTVARSAVQPARLQA
SAHQKALAKDQTNEGKELAEQGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRIDMRQR
RMNARYQTQPVTLGEVEQVQSGKLIPFSPAVNTSVSTVASTVAPMYAGDLRTKPPPDDNA
SATDYKFSSSIENSDSPVRSILKSQAWQPLVESSGNKGMLREYGETESKRAWTSRDSGME
KYGSFEEAEVSYPILNRAREGDSHKEPKYAVPRKGSLERANPPITHLGDEPKEFSMAKTN
AQGNLDLGDRLPFEEKVEVENVMKRKFSLRAAEFGEPTSEQTGTAAGKTVAQTAAPVSWK
PQDSSEQPQEKLCKNPCAMFAAGEIKTPTGEGLLDSPSKTMSIKERLALLKKSGEEDWRN
RLSRRQEGGKAPASSLHTQEAGRSLIKKRVTESRESQMTIEERKQLITVREEAWKTRGRG
AANDSTQFTVAGRMLKKGLASPTAITPVASPICSKTRGTTPVSKPLEDIEARPDMQLESD
LKLDRLETFLRRLNNKVGGMQETVLTVTGKSVKEVMKPDDDETFAKFYHSVDYNMPRSPV
ELDEDFDVIFDPYAPKLTSSVAEHKRAVRPKRRVQASKNPLKMLAAREDLLQEYTEQRLN
VAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNSNNSAVPYKRLM
LLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELATLIQ
TKRELGCRATYIQTIEEGINTHTHAAKDFWKLLGGQTSYQSAGDPKEDELYEAAIIETNC
IYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAK
HLWNGTFDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTE
LKRPNEKNPGELAQHKEDRADVKPYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRR
QFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRA
AGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVV
HSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLW
HGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALGRRDRK
AYDCMLQDPGSFNFAPRLFILSSSSGDFAATEFVYPARAPSVISSMPFLQEDLYSAPQPA
LFLVDNHHEVYLWQGWWPIENKITGSARIRWASDRKSAMETVLQYCKGKNLKKPPPKSYL
IHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLAR
PLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNTLPAWKQVNLKKAKGLF
Download sequence
Identical sequences ENSMMUP00000001839 ENSMMUP00000001839 9544.ENSMMUP00000001839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]