SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001887 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001887
Domain Number 1 Region: 1-140,174-198
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.38e-35
Family BAR domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001887   Gene: ENSMMUG00000029176   Transcript: ENSMMUT00000002001
Sequence length 211
Comment pep:novel chromosome:MMUL_1:20:23435178:23459039:-1 gene:ENSMMUG00000029176 transcript:ENSMMUT00000002001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEKTEVLSEDLLQIERRLDTVRSVCHHSHKRLVACFQGQHGTDAEKRHKKLPLTALAQN
MQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIVDPLYGIAEVEIPNIQKQ
RKQLAKLVLDWDSVRAHCNQEHSISSFALVDLPKPFSFLKFSVGVVGVTSPLPFTQDQLA
ADMYNFMAKEGEYGKFFVTISGRKNQPLGLP
Download sequence
Identical sequences ENSMMUP00000001887 ENSMMUP00000001887 9544.ENSMMUP00000001887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]