SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001953 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001953
Domain Number 1 Region: 26-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000863
Family Dystroglycan, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001953   Gene: ENSMMUG00000001466   Transcript: ENSMMUT00000002068
Sequence length 387
Comment pep:known_by_projection chromosome:MMUL_1:16:34402822:34414622:1 gene:ENSMMUG00000001466 transcript:ENSMMUT00000002068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTLFWTPLLEVLLAGLGDCEAQQTTLYPLVGRVFVHTLDHETFLSLPEHVAVPPAVHI
TYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGRQVIEVTAYNRDSFDTTQQRL
VLEIGDSEGPLLPYQAEFLVRSHDVEEVLPSAPASRFLSALGGLWEPGELQLLNITSALD
RGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHF
RIDWCNVTLVDKSVPEPADEMPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLV
ALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAANREVPRPLSTL
PMFNVRTGERLPPRVDSAQVPLILDQH
Download sequence
Identical sequences ENSMMUP00000001953 9544.ENSMMUP00000001953 ENSMMUP00000034892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]